KEGG   Bordetella petrii: Bpet1073Help
Entry
Bpet1073          CDS       T00637                                 

Definition
(GenBank) putative membrane protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Plasmid_RAQPRD
Motif
Other DBs
NCBI-ProteinID: CAP41405
UniProt: A9IBA8
Position
1139615..1139998
Genome map
AA seq 127 aa AA seqDB search
MVASIWLRAAHRGVPTFLVTALVLGQSPMALAESPAQRQELVAALRQLDALERTVADSAA
HTPITPGERYHFDYPRLLADLARVRAGIQAHLTPSRAQPRDPSELASDYRTERTASPPPK
TTAEGKQ
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggtggcttcgatctggctgcgcgccgcgcatcgcggcgtgcccacttttctcgtgacg
gccctcgtgctgggccagtccccgatggcgttggccgaatccccggcgcagcgccaggaa
ctggtcgccgcgctgcgccagctcgacgcgctggagcgcaccgtcgcggacagcgccgcg
catacccccatcacgcctggcgagcgctaccacttcgactacccgaggctgttggctgac
ctggcgcgcgtgcgcgccggcatccaggcccatctcactccgtcgcgtgcccagccacgc
gacccctccgaacttgccagcgactaccgcaccgagcggaccgcttcgccaccgccgaag
acgactgcggagggcaagcaatga

DBGET integrated database retrieval system