KEGG   Bordetella petrii: Bpet1076
Entry
Bpet1076          CDS       T00637                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: DUF3487 TraL
Other DBs
NCBI-ProteinID: CAP41408
UniProt: A9IBB5
Position
1140617..1141027
AA seq 136 aa
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTI
AIAPTFVVLGVALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRYPLMAGWVGGHVLIS
RSGFWTTRRSASRGAR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtccgagcagcagcacgtccgtgcggacgggaccgtgacgttccttccgcatcggctc
aaccgccaccccgttgtcgtgcgcggcctcaccgccgacgagctgtggatctgctgcggc
ttgtccggtgcggccggcctgctggtcggcgcaccgctgtcctgggtgttccgcacgatc
gccatcgcgccgacgttcgtcgtcctgggcgtagccctgggcgtcttcatcggcggcggc
atcctgcgccgcctcaagcgcgggcgccccgacacctggctgtatcggcaactgcaatgg
cgcatcgctacgcgctatccgttgatggcgggctgggtgggcggccacgttctgatctcg
cgctcaggcttctggaccacccgacggtctgcatcaaggggagcacgatga

DBGET integrated database retrieval system