KEGG   Bordetella petrii: Bpet1081
Entry
Bpet1081          CDS       T00637                                 
Name
(GenBank) conserved hypothetical protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 TrwB_AAD_bind FtsK_SpoIIIE AAA_10 T2SSE ATPase_2 AAA_7 AAA_16 DUF87 AIG1
Other DBs
NCBI-ProteinID: CAP41413
UniProt: A9IBC5
Position
1144468..1147356
AA seq 962 aa
MRWKLPWAKPAAPTLAASGGGDDEQPDGWQRHVEALHQAGIPEPGAAVQDRRPATVADEQ
VLYDVAPSFVELLPWVEFLPESKTMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALE
NALQDSFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARGTAFTEFYLRFFGHHLR
AVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYRRASGQGQANRRGQTPEQMLGIVCDRLCG
GLANAGIQARRMVAADVHDWLLRWFNPHPTLLGPDAEDRERFYSLAHYPEETEAGEIELA
SGRDFSQRLFFGQPRSDVAQGAWYFDGMPHRVLITDRLRMPPGTGHLTGETRKGDAINTL
FDQMPEDTVMCLTMVATPQDVLESDLNHLAKKAVGETLASEQTLKDVHEARALIGSAHKL
YRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGK
DRRRWYTQLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLF
LFGPTGSGKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFARRLGLTVNRVKLAPGS
GISLAPFADARRLIETPSDVQTLDADALDEDLPPDASAMEADEQRDVLGELEITARLMIT
GGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRTRGQDPTLPEMRRV
RLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLIST
VNNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWYWLATQNIDDLP
RAAEPMLNMIEWWLCLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSM
EVLFRAVPPSLYLALAQTEPEEKAERYQLMQQYGCTELEAAFKVAEKIDQARGIESPALE
LS
NT seq 2889 nt   +upstreamnt  +downstreamnt
atgcggtggaaacttccctgggcgaagccggccgcaccgacgctggccgcatccggcggt
ggtgatgacgagcagccggacggctggcagcgccacgtcgaggccttgcaccaggccggc
atccccgaacccggcgccgcggtccaggaccgcaggccggcgaccgtggccgacgagcag
gtgctctacgacgtcgccccgtccttcgtggaactgctgccctgggtggagttcctgccc
gagtcgaagaccatgctgctggaggacggtcagtccgtggccgccttctacgaactggtg
ccgctgggcaccgaaggccgggaacccggctggcttgcgcatgcccgcgatgccttggag
aacgcgctccaggactccttcgatgagctggacgagaacccgtgggtgctccaactctac
gcccaggacgaaccgagcttcgaccagtacatgcagacgctgcgcgactatgtgcagcca
cgtgcgcgcggcacggcattcaccgagttctacctgcgcttcttcggccaccacctgcgc
gcggtggccaagcccggcggcctgttcgaggacacggtggtcacgcggctgcgctggcgc
ggccagacgcggcgcgtgcgcatggtggtgtatcgccgcgcgagcggacagggacaggca
aatcgccgcgggcagacgcccgagcagatgctgggcatcgtctgcgaccgcctgtgcggc
ggcctggcgaacgccggcatccaggcacggcgtatggtcgcggccgacgtccacgactgg
ctcctgcggtggttcaacccgcatcccacgctgctcgggcctgacgctgaggatcgcgag
cgcttttactcgttggcgcactaccccgaagagaccgaggccggcgagatcgagctggcg
agcgggcgggatttcagccagcggctgttcttcggtcagccacgctcggacgtggcgcaa
ggggcctggtacttcgatggcatgccgcatcgcgtgctgatcaccgaccggctgcgcatg
ccgcccggcaccgggcacctgaccggcgagacccgcaagggcgatgcgatcaacacgctg
ttcgaccagatgcccgaagacacggtgatgtgcctgacgatggtcgccacgccacaggat
gtcctcgaatcggacctcaaccacctggcgaaaaaagccgtgggcgagacgctggcgtcg
gagcagacgctcaaggatgtgcatgaggcgcgcgcgctgatcggcagcgcgcacaagctc
taccggggcacgttggcgttctacctgcgcggtcgcgacgaggcggagctggaccggcgc
gggctggatctcgcgaacgtgatgctcaacgccggcctgcagccggtgcgcgaggacgac
gaggtagcgccgctcaacagctatctgcgctggctgccgtgctgctacaaccccggcaag
gatcggcgccgctggtacacgcaactgatgttcgcgcagcacgccgccaatctctcgccg
gtatggggacgcgcccagggcacgggccaccccggcatcacgatgttcaatcgcggaggt
ggcccgattacgtttgaccccttgaacaggttggatcggcagatgaatgcccatctgttc
ctgttcggccccaccggctcgggcaagtccgccacgctcaacaacctgctgaaccaggtc
acggccatctaccggccgcggcttttcatcgtggaggctggaaattcgttcgggcttttc
agcgacttcgccaggcgcctggggctgaccgtgaaccgggtcaagctggccccgggctcg
ggcatcagtctggcgccgttcgccgacgcacgacggctgatcgaaacgcccagcgacgtg
cagacgctcgatgccgatgcactggacgaagacctgccaccggatgcctcggccatggag
gcggacgagcagcgcgacgtgctgggcgagctggagatcacggcacggctgatgatcacg
ggcggcgaggacaaggaagaagcgcggatgacgcgggccgaccgctcgctgatccgccag
tgcatcctcgatgcggctgaacactgcgtggccgagaagcgcaccgtgctcacgcgcgat
gtgcgcaatgcgctgcgcacccgcggccaagacccgacgttgcccgagatgcggcgcgtg
cggctgcttgagatggcggatgcgatggacatgttctgccaaggcacggacggcgagatg
ttcgaccgcgatggcacgccgtggcccgaagccgacatcacgctggtggatctcgcgacc
tatgcccgcgagggctacaacgcgcagctctccatcgcttacatctcgctgatcagcacc
gtcaacaacatcgctgagcgcgaccagtacctgggtcgtccgatcatcaacgtgaccgac
gaaggccacatcatcaccaagaacccgttgctcgcaccctacgtggtcaaaatcacaaaa
atgtggcgcaagctaggggcctggtactggctagctacacaaaatatcgacgatctgccg
cgtgccgcggagcccatgctcaacatgattgagtggtggttgtgcctgtcgatgccaccg
gacgaagtggaaaagatcgctcggttccgcgaactctcgccggcgcagaaggcgctgatg
ctgtcggcacgcaaagaagcaggcaagttcaccgaaggcgtgatcctgtcgaagtcgatg
gaagtgctgttccgcgccgtgccgccgagcctttacctcgcgcttgcgcagaccgaaccc
gaagagaaggccgagcgctaccagctcatgcagcaatacggctgcaccgaactggaagcg
gccttcaaggtggccgagaagatcgaccaggcacgcggcatcgagtcgcccgccttggaa
ctgtcgtaa

DBGET integrated database retrieval system