KEGG   Bordetella petrii: Bpet1084
Entry
Bpet1084          CDS       T00637                                 

Definition
(GenBank) putative secreted protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: DUF1525 Thioredoxin_3
Other DBs
NCBI-ProteinID: CAP41416
UniProt: A9IBD2
Position
1148967..1149413
AA seq 148 aa
MPASSSRFASGWRTLGLAVALPASLAGFSPASFAADVVVITDSRHPVKAMGGERLIELDE
AHRIEAELSAALPADPEQATATVNRRLSQGAADLQRRIATAYQGVADAWSLGITTIPAVV
VDQRYVVYGEPDVARAIARVELHRRAEP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgccagcatcttcatccaggttcgcatcgggctggcgaacccttggcctggccgttgcg
ctgccggcttccctggccgggttcagcccggccagtttcgccgccgatgtggtggtcatt
accgacagccgccacccggtcaaagccatgggtggcgagcggctgatcgagttggatgaa
gcgcaccggatcgaagcggagctttctgcagcactgcccgccgatcccgaacaggcaaca
gccacggtgaaccgccggctgagccagggggctgccgatctccagcgtcgcatcgccact
gcataccagggcgtcgccgacgcatggagcctgggcatcaccaccattccggctgtcgtg
gtggatcagcgctacgtggtctatggcgagcctgacgtggcccgcgccatcgcgcgcgtc
gagctgcaccggagggccgaaccgtga

DBGET integrated database retrieval system