KEGG   Bordetella petrii: Bpet1086Help
Entry
Bpet1086          CDS       T00637                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAP41418
UniProt: A9IBD7
Position
1150367..1151761
Genome map
AA seq 464 aa AA seqDB search
MKRPEPMSLSARACRLLRPTPLAGALALVCSLAWAQVGYQNSGPVIGDDVMYSIGGGSAV
SMGRAAGMRSIGVGVGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVAS
LPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMA
LRDAVGSNDAVSAVEQAETRRGNDGVPWVGGSNAGGAGQSAIRVVGDVTRAGYNLVNGRG
VTDTSSIASASCASLSCQTWTSPQQATEWATRVLGEQVQRTCDSCTKTETVPGVGLTPLI
QEEYEAKLEVLQELVSGTRNTTFENLRDAGSTSLPITRGVIEALRDEPDQDLLARRLASE
VALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGGRP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcccgaaccgatgagcctttctgccagggcatgccgcctgttgcgcccgaca
ccgctggctggcgcgctcgccctggtctgcagcctggcatgggcacaggttggataccag
aacagcgggcccgtcatcggcgatgacgtcatgtactcgatcggcggcggcagcgcggtg
tccatgggtcgcgcggccggcatgcgctccatcggggtcggcgtggggtggaacagcaac
ctgatctgcggcgacatgagcatccagaccacgctgcgcaatcagctcaacggcatcacg
aacggcttccagcagatcatgagcaacgtgatccagagcgccaccagcgcggtggcgtcc
ctgccggcgctgatcatccagcgcgccgacccgggtctgtacaacctgttgaccaacggc
gtgctgcaggcgcggctggacttcgaccgctccaagctgacgtgccgcgcgatggccgag
aagatggccgagacggcgggcggccaacttggctggagccagatggcggaaggcatggcg
ctgcgggatgcggtgggaagcaacgatgccgtctcggccgtcgaacaggccgagacgcgc
cggggcaacgacggcgtgccctgggtgggcggcagcaatgccggtggcgcaggccagtcc
gccatccgggtggtcggcgacgtcacccgcgcgggatacaacctcgtcaacggtcgcggc
gtgaccgacacatcctccatcgcgtccgccagttgcgcgagcctgtcctgccagacctgg
acgtcgccgcagcaggcgaccgaatgggccacacgggttctcggggagcaggttcagcgc
acgtgcgactcatgcaccaagaccgagacggtgcccggcgtcgggctgacgccgctgatc
caggaagagtacgaggcgaagctggaggtcctgcaggagctagtttccggcacgcgcaat
accaccttcgagaacctgcgcgacgctggcagcacgtcgctgccgatcacgcgcggtgtc
atcgaagcgctgcgcgacgaaccggaccaggaccttctggcgcggcgcctcgcgtccgag
gtggcgctgtcgtcggtgctcgaaaaagcgctcctgctccagcgtacgctacttacgggc
aagaaggagcccaacgtcgcagccaacgaactcgcggtcgaggccgtgaaccacgagagc
gacacgctcgaccgggagatccgcaacctgaagacggagctggagcttcggcgcgagctg
gcaaacaactcaccgatggccatcatccagcggcacggcacgcgcgcagccggttcgcgc
ggcatctacgagggcgatccggtacccgaccgccttgaccagttgcagaagggcaatccg
ggaggccggccatga

DBGET integrated database retrieval system