KEGG   Bordetella petrii: Bpet1174Help
Entry
Bpet1174          CDS       T00637                                 

Gene name
scoB
Definition
(GenBank) 3-oxoacid CoA-transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bpt  Bordetella petrii
Pathway
bpt00072  Synthesis and degradation of ketone bodies
bpt00280  Valine, leucine and isoleucine degradation
bpt00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bpet1174 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bpet1174 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet1174 (scoB)
Enzymes [BR:bpt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Bpet1174 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CAP41508
UniProt: A9IC09
Position
1231815..1232453
Genome map
AA seq 212 aa AA seqDB search
MAWTHDQMAARAAQELHDGDYVNLGIGLPTKVVQYVPDGMQVWLQSENGLIGIGPPPYED
EIDPDLIDAAKQTVTTAPGASICSSSMSFAMIRGGHMDLTILGAMQVSAQGDLANWMIPG
KMVKGMGGAMDLVGGARRVIVLMEHNTRDGAMKILDQCSLPLTGRSVVHRIISDLAVMDI
TDEGLVVKELAPGVTREALQEKSEPRLVFALG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacacatgaccaaatggcagcgcgcgccgcacaggaactgcacgacggcgac
tacgtgaatctgggaataggcttacccacgaaagtggtgcaatacgtgcctgacggcatg
caagtatggttgcagtccgaaaacggactgatcggcatcgggccgcccccttatgaggac
gaaatcgacccggaccttatcgacgcggccaagcagacggtgacaacagcgcctggcgca
tccatctgttcgtcttccatgtcgttcgccatgatccgaggcggccatatggaccttacg
atcctgggagccatgcaggtcagcgcgcagggagaccttgcaaactggatgatccccggc
aagatggtcaaaggcatgggcggggccatggatcttgttggtggcgcgcgccgggtcatt
gtgctcatggaacacaacacgcgtgacggtgcgatgaaaattctggatcagtgctctttg
ccgctgaccggtcgtagcgtggtgcacaggatcatttccgacctggcggtgatggacatc
accgacgaagggctggttgtaaaagagctggcgcccggcgttacgcgcgaggcattgcag
gaaaagtcggagcctcgcctggtgtttgcactcggatag

DBGET integrated database retrieval system