KEGG   Bordetella petrii: Bpet1268Help
Entry
Bpet1268          CDS       T00637                                 

Definition
(GenBank) polar amino acid transport system permease protein
  KO
K23062  hydroxyproline transport system permease protein
Organism
bpt  Bordetella petrii
Pathway
bpt02010  ABC transporters
Module
bpt_M00865  Hydroxyproline transporter system
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bpet1268
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpt02000]
    Bpet1268
Transporters [BR:bpt02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Hydroxyproline transporter [MD:M00865]
    Bpet1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAP41602
UniProt: A9IDS2
Position
complement(1331503..1332168)
Genome map
AA seq 221 aa AA seqDB search
MLDYTFYWSQVWDKWPALLEGARQTLEVTALSMLLGTLLALPLALMRRSKSGTPYYFATT
WVEVSRNTPALFQIYMAYFGLGAVGVDIPSFTALLIALTFNNAGYLAETFRGGLSAVPPT
QMAAARSLGMSPTKAYVHVIFPQVFVLVFLPYMNQLNWALLNSSLGSIIGVRELTGATQA
AQSESFRTFEFFIVAAGMYYVISKLISIVAALVTWRLYKRT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattacacgttctattggtcccaagtctgggataaatggccggccctgctagag
ggtgcccgccagacgcttgaggtgaccgcattatcgatgctgttgggcactctgcttgcc
ctgccgctggcactgatgcgccgttcgaagtccggaaccccttactacttcgctaccacc
tgggtcgaggtgtcgcgcaatacgccagctctgttccaaatctacatggcgtacttcggg
ctgggtgcggtcggtgttgacattcccagtttcacggccctgctgatcgcgctgacgttc
aacaacgccgggtacctggccgagaccttccgaggcggattgtcggcagtgccacccacc
cagatggccgctgcgcgttcgctggggatgtcacccaccaaagcctatgtgcacgtgatc
ttcccccaagtcttcgttctggtgttcttgccgtacatgaatcagctcaactgggctctg
ctcaacagttcactggggtcaatcatcggggtgcgcgagttgacgggggccacgcaggcc
gcacagtccgaatcgttccggacctttgagttcttcatcgtggccgcgggcatgtactac
gtgatttccaagctgatcagcatcgtggccgccctggtgacctggcggctttacaagagg
acgtga

DBGET integrated database retrieval system