KEGG   Bordetella petrii: Bpet1350Help
Entry
Bpet1350          CDS       T00637                                 

Definition
(GenBank) putative membrane protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4400
Motif
Other DBs
NCBI-ProteinID: CAP41685
UniProt: A9IE52
Position
1409502..1410251
Genome map
AA seq 249 aa AA seqDB search
MNDPAATAQRQQNRQQGLIASTITLPFRLFGVLCGSLLLCIVIECVGMHLFWPDQGWRHA
QGMLDYELAQLSGHFTRSALVQEPGRTAHWLVEQAYEWIFIKTGLLEWMRNAANQASAPS
HSGTRDFRYYISQAYVWIESYLIAAAFTTLVFIVRLMVLVLTLPLFLMAAFVGLVDGLVR
RDIRRFGAGRESGFIYHRAKASLMPLAVLPWVIYLALPVSISPLLILLPSAVLLGLATDI
AAGSFKKYL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatccggccgccaccgcacaacgccagcagaaccgccagcaaggtctgattgcc
agcaccatcacgctgccgtttcgtctgttcggcgttctgtgcggctcgctgctcctttgc
atcgtcatcgaatgcgtgggcatgcacctgttctggccggaccagggatggcggcacgca
cagggcatgctcgactatgaacttgcccagctctccggtcatttcacccgcagcgctctg
gtgcaggaaccgggacgcactgcgcattggctggtcgaacaggcctacgaatggatcttc
atcaagacaggcttactggagtggatgcgcaacgccgcgaaccaggccagcgcccccagc
catagcggaacacgcgatttccggtactacatcagccaggcatatgtctggatagaaagc
tacctgatcgccgcagcgttcacgaccctggtgttcatcgtgcgcctgatggtgctggtg
ctgacattgccgctgttcctgatggccgccttcgtggggctggtcgacggcctggtgcgc
cgcgacattcgccgtttcggcgccgggcgcgaatccggcttcatctatcatcgcgccaaa
gcatcgctgatgccgctggccgtactgccctgggtgatctatctggcgcttcctgtgagc
atcagccccttgctcatcctgctgccgagcgcggtgctgctgggattggcgacggacatc
gcagccggaagtttcaaaaagtatttgtga

DBGET integrated database retrieval system