KEGG   Bordetella petrii: Bpet1357Help
Entry
Bpet1357          CDS       T00637                                 

Definition
(GenBank) putative membrane protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 TraL Oleosin
Motif
Other DBs
NCBI-ProteinID: CAP41692
UniProt: A9IE65
Position
1413767..1414168
Genome map
AA seq 133 aa AA seqDB search
MPEHQDVRPDGTVAFLPHRLNRHPVVVRGLTADELWVCAGLSGAAGLSVGIPLAIVFSMI
AIAPTAIVLGIAAGVFAGGGMLRRQKRGRPDTWLYRQIQWWIARRHPGLAQFIGGRDLVT
RSGYWTTRRRTAS
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcatcaggacgtccggcctgacggaacggtagcgttcctgccgcatcgcctc
aatcgccatcccgtggtcgtgcgcggcctcacggcggatgagttgtgggtgtgcgcaggc
ctgtcgggcgcggccggcctgtcggtgggcattccgctggcgattgtcttctcgatgatc
gccatcgcgcccaccgccatcgtgctcggcattgccgccggcgtcttcgccggcggcggc
atgctgcgccgccagaaacgcggcaggcccgacacctggctgtaccggcagatccagtgg
tggatcgcgcggcggcatcctggcctggcccaattcatcggcggccgcgatctggtgacc
cgttcgggctactggaccaccagacggaggaccgcctcgtga

DBGET integrated database retrieval system