KEGG   Bordetella petrii: Bpet1360Help
Entry
Bpet1360          CDS       T00637                                 

Definition
(GenBank) putative exported protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-F_leu_zip Mod_r YabA Golgin_A5 DUF2968 MAD Macoilin DUF3552 SWIRM-assoc_1 DUF2383 DUF4407 Casc1_N
Motif
Other DBs
NCBI-ProteinID: CAP41695
UniProt: A9IE70
Position
1415752..1417200
Genome map
AA seq 482 aa AA seqDB search
MKGNGLLKWLMIPMALLLVFVGVKLFSGGGGSQPGRDGGTQLTPEEARALGIEGDTPRDT
VATLVGQVRQLRTELQTALTDNKTQKAENERLRQREGAIDRRIQSALETERNQLKNDREQ
VASERQQTQGLLQDLQRQFENLSGKNGHADLPVGLGLEPGDGAGLGTDGVRWIEPEDARS
DGKSRSPGTTGSFTFPNSFGPAQKTLDTTRETVADAGAKAAGISTARPVYTVPTNATLMG
SISMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDIPDVAGAVVSGTASGDWTLSCV
RGQIRSVTFVFHDGTIRTVPEDGERGGNRQQNGNGNGNGSSTQDGLGWISDPYGIPCVSG
ERRSNAQQYLGTQALITAAGAGAASLIKSDNGSVAVVANNNGSLGTVGISGNEAMGRILA
GGVQDMSQWVNKLYGQAFAAVYVKPGARVAVHLEQPLTIDYDPKGRKVDHRLGGASDAQD
LD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtaatggcctgctcaagtggttgatgatcccgatggcgctgctgctggtgttc
gtcggcgtgaagctgttttccggcggcgggggaagccagcctggtcgggacggcggaacc
cagctcacaccggaagaagccagggcgcttggcatcgaaggcgacacgccacgggatacg
gtggccaccctggtcggccaggtccggcagctgcgcaccgaactgcagacggcgctgacc
gacaacaagacccagaaggcggagaacgaacgcctgcgtcagcgcgagggtgccatcgat
cgccgtatccagagcgccctggagaccgagcgcaaccagctgaaaaatgaccgtgaacag
gtcgccagcgaacgccagcaaacccagggcctgctgcaggacctgcagcgccagttcgaa
aacctgagcggcaagaacggccatgccgatctgccggtcgggcttggccttgaacccggc
gatggcgccgggctcggaaccgatggcgtgcgatggatcgagccggaagatgcgcgcagc
gacggcaagagccgcagccccggcaccaccggaagcttcacattcccgaacagcttcggc
ccggcacagaagacgttggacaccacccgggagacggtcgcggatgccggagccaaggcg
gccggcatctccaccgccaggccggtctataccgtaccgaccaacgccacgctgatgggt
tcgatttcgatgacggcattgatcgggcgcgtcccgatcgacgggaccgtgaacgatccg
taccccttcaaagtcctgatcggcccggacaatctcaccgcgaacggcatcgacattccc
gatgtcgccggtgcggtcgttagcggcacggcgtcgggcgactggacgctctcttgcgtg
cgcgggcagatccgctcggtcaccttcgtgttccatgacggcaccatccgcacggtgccg
gaggacggcgagcgtggcggcaaccgccagcagaacggcaacggcaatggcaatggcagc
agtacgcaggatggcctcggctggatcagcgatccctatggcattccctgcgtgagcggt
gaacggcgcagcaacgcccagcaatatctgggcacccaggcgttgatcaccgcggctgga
gccggcgccgcctcactgatcaagtccgacaacggcagcgtggcggtggtcgccaacaac
aacggctcgctcggcacggtcggcatttccggcaacgaagccatgggccgcatcctggcc
ggtggcgtccaggacatgtcgcagtgggtgaacaagctctatggccaggcgttcgcagcc
gtctacgtcaagcccggcgccagggtcgcggttcatctcgaacaacccctcaccatcgat
tacgacccgaaggggcgcaaggtcgatcatcgtctcggaggtgcttctgatgcacaggat
ctggattaa

DBGET integrated database retrieval system