KEGG   Bordetella petrii: Bpet1481Help
Entry
Bpet1481          CDS       T00637                                 

Definition
(GenBank) conserved exported protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: CAP41816
UniProt: A9IFX9
Position
1532671..1533261
Genome map
AA seq 196 aa AA seqDB search
MAAPTLTAPLRALVLAAGLCVCAARAQEIPPPAYQLAAQRAGIPSAVLYAVALQESGIRR
NGRIVPWPWSLNVAGQSRRYATRADACAGLQQAMRSTPHTRIDVGLGQINLGYQQQRYAS
ACDLLDPYRNLAIAAEILKEQHTAGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQG
THPTAAVLAARQETSP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgccaaccctgacggcgccgttgcgcgcactggtgctcgctgctggcctctgc
gtctgcgccgcccgggcccaggaaattccaccaccggcctaccagcttgccgcccagcgc
gcgggcattccctcggcggtgctctacgccgtggccttgcaggagagcggcatccggcgt
aacggacgcatcgtcccgtggccttggtccctcaacgtcgccggccagtcgcgccgctac
gcgacccgcgccgacgcctgcgccggtttgcagcaggcgatgcgctccacgccgcacacg
cgcatcgacgtgggcctgggtcagatcaacctcggctaccaacagcagcgttacgccagc
gcgtgcgacttgctcgacccgtaccgcaacctcgccatcgctgccgagattctgaaggag
cagcacaccgccggtgaggactggttgctggcgatcggccgctaccaccgtccggcgggc
ggtgagcccgctgcccgctatcgccgcagcgtgtcccgccacctcgcgcgcgtgcagggc
acgcacccaaccgccgcggtcctcgccgcgcgccaggagacctccccatga

DBGET integrated database retrieval system