KEGG   Bordetella petrii: Bpet1483
Entry
Bpet1483          CDS       T00637                                 
Name
(GenBank) putative plasmid-transfer-protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: CAP41818
UniProt: A9IFY3
Position
1533811..1535997
AA seq 728 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYR
DARVILRYRRNIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYV
EPTPAYRLTRRLEERLEFARFPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPEEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRKNAAGEHEVVIVIDPKGDADLLKR
MYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMSSVPMIEPSHIVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPQDLQQLAGYMRQSYSEATQWWEFTSSPALQDGALPDDLLDDAAAVEPGLVATDD
SAGNEASP
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtcggggaaacagccggtcgaggtgctgcttcgcccagcggtggagctatataccgtc
gcggcgtgtgcgggcgccgcgtttctgtccctggtggccccgtggtcgctcgcgctgagc
cccgccatgggtgtcggcagcgcgttggcgttcggggcctatggcgcgatccgctaccgc
gatgcccgcgtcatcctgcgctaccggcgcaacatccgccgcctgccgcgctacgtgatg
accagcaaggacgtgccggtcagccagcaacgtctgtttgtggggcgcggctttttgtgg
gagcagaaacacacccataggctcatgcagacataccggccggagtttcggcgctacgtc
gagccgacgccggcctaccgactgacgcggcgcctggaggaacggctggagttcgcgcgg
ttcccgctttcccggctgccgaaactcaccggctgggacgtgcctttcaacccagtgcgc
ccgctgccgcccgtgggcggactgcctcggctgcacggcatcgaacccgaggaggtggac
gtcagcctgccgctcggcgagcgcgtcgggcactcattggtcttggggacaacccgcgtg
ggcaagacgcggctggccgaactgttcgtgacccaggacatccggcgaaagaacgcggcg
ggagagcacgaggtcgtgatcgtcatcgaccccaaaggggatgccgatctgctgaagcgg
atgtacgtcgaggcgcaacgcgcgggccgcgagggcgagttctatgtcttccatttgggc
tggccggacatttccgcccgctacaacgccgtggggcgctttggacgtatcagcgaggtg
gcgacccgcattgcagggcaactctccggtgaaggcaactcggcggctttcagggaattt
gcctggcgcttcgtcaacatcatcgcccgcgccttggtggaactggggcagcgtccggac
tacatgctgatccagcggcatgtcatcaacatcgacgcgctgttcatcgagtacgcccag
cactacttcgccaagacggagccgaaagcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccgcgcaacatgatcgggcgcgagaagcgcgtggtggcgctg
gagcagtacctgtcccaagcccgcaactacgaccctgtgctggacggtttgcgctctgcc
gtgcggtacgacaagacgtatttcgacaagatcgtcgccagcctcttgcctctgctggaa
aaactcacgagcggcaagatcgcgcagctcctggccccgaactattccgacctggccgac
ccgcgcccgatcttcgattggatgcaggtcattaggaagcgggccatcgtctatgtgggc
ctggacgcgctgtccgatgccgaggtcgccgcagcggtcggcaactcgatgttcagcgat
ctcgtctcggtcgcaggccatatctacaagcacgggatcgacgatggcctgccgggcgct
tcggccggcgcgcgcgtgccgatcaacgtccatgccgatgagttcaacgagttgatgggt
gacgagttcattccgctgatcaacaaaggtggtggcgccgggctgcaagtcaccgcgtac
acgcagaccctctcggacattgaggcccgcattggcaaccgcgccaaggccggtcaggtc
atcggcaacttcaacaacctgttcatgctgcgcgtgcgcgagaccgcgaccgctgaactg
ctgacccggcaactaccgaaggtcgaggtttatacgaccaccatcgtcagcggcgcgacc
gacagctcggacattcgcggggcgacggatttcacgtccaacactcaggaccgcatcagc
atgtccagcgtgccgatgatcgagccgtcgcacatcgtcggcttgcccaagggccagtgt
tttgcattgttgcagggcggccaactttggaaggttcgcatgccgctgccggcaccggac
cccgatgaggtcatgccacaggatctgcaacaactcgcgggctacatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagctccccggcgctgcaggacggggccttg
cccgacgacctgctggatgatgctgctgcggtcgaacctggccttgtggccaccgacgac
agcgccggcaacgaggcctcgccatga

DBGET integrated database retrieval system