KEGG   Bordetella petrii: Bpet1492Help
Entry
Bpet1492          CDS       T00637                                 

Definition
(GenBank) putative exported protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0242 Golgin_A5 Macoilin Pex19 YabA APG6_N DUF3552 FUSC
Motif
Other DBs
NCBI-ProteinID: CAP41827
UniProt: A9IG00
Position
1540390..1541808
Genome map
AA seq 472 aa AA seqDB search
MRSNGLLKWLMIPVALLVLFVAIRMFSGGSSSAPPAADAGAKLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTVLSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQQ
QAASERQQTEGLLADLQRRLESIGGRGGGHADLPVGLGLRDGDEAGMEGGVRWVEPNDAK
PADGRNGSRATGGGTSFPTSFGPAQSTLETTAKTVANAGARAAGVKSAKPVYTVPTNSTL
MGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLS
CVRGQVRSITFVFHDGTIRTIPEDRDGNQQNNQQRDGLGWISDPYGIPCVSGERRSNAQQ
YLGSQALITAAGAGVASLIDSDSGQMSYVGADGSIGSVGISSNEAVGRILAGGVRDMADW
VNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtaacggactcctgaagtggttgatgatccccgtggccctgctggtgctgttc
gtcgccatccggatgttttcgggtggaagctcgtctgcgcctcccgccgcggatgccggc
gccaagctcacgccggaggaaatgaaggcgctgggcatcgagggcgataccccccgcgat
accgtagcgacgctcgtggcgcaggtgaagcagttgcgcaccgagcttcagacggtcctg
tccgacaacaagtcccagcgcgaggagaaccagcgcctgcgccaacgcgagaactcgatc
gaccagcgcatcaattcggccctcgaatccgagcgctccaacctgcgccgcgaccagcag
caggcggccagcgagcgccagcagaccgaggggctgctcgccgacctacagcggcgcttg
gaaagcatcggcgggcgtggcggcggccacgccgatctacccgtgggcctgggactgcgt
gacggcgacgaggcaggcatggaaggcggcgtgcgctgggtcgagccgaacgacgctaag
cccgctgatgggcgtaacggcagtcgtgccacgggtggcggcacgagctttccgacgagc
ttcggccctgcgcagagcacgctggaaaccacggcgaaaaccgtggcgaacgcgggcgcc
cgcgccgcaggcgtcaagagcgccaagccggtctatacggtgcctaccaactcgacgctg
atggggtcggtggctatgacggcgctgatcggccgcgtgccgattgacggcacggtcaac
gatccgtatccgttcaaagtcctggtcggccccgacaacctcacggcaaacggcatcgac
attcccgatgtggccggcgccgtgttttccggcactgcctcgggcgactggacgctctct
tgtgtgcgcggccaggtgcgcagcatcacctttgtgttccatgacggaaccattcggacg
attcccgaagaccgcgacggcaaccagcagaacaatcagcagcgcgacggattgggctgg
atcagcgacccgtatggcattccttgcgtcagtggagagcggcgcagcaacgcccagcaa
tacctcggttcgcaggcgctcatcaccgcggcgggtgcgggcgtggcctcgcttatcgac
agcgacagcggccagatgtcctacgtgggcgcagacggttccatcggcagcgtcggcatt
tccagcaacgaagccgtaggtcgcatcctggccggtggcgtgcgggacatggccgattgg
gtgaacaagttgtacggccaggccttcgccgccgtctatgtccaacccggcgcgaaggtc
gccgtccatctcgaaaagccgctcgccatcgatttcgatcccgaaggccgcaaggtcgat
caccgcgcaggagaaagccatgctctcgaacttgaataa

DBGET integrated database retrieval system