KEGG   Bordetella petrii: Bpet1503Help
Entry
Bpet1503          CDS       T00637                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAP41841
UniProt: A9IG26
Position
1553000..1554397
Genome map
AA seq 465 aa AA seqDB search
MKFRPAFNPFSPRVPRTKIVLALAGALALASGVAWGQLGYQTGGSVIGDDVMYSIGGGSA
VSMGRAAGMQSIGVGVGWNSNLVCGDMSLQTTLRNQLNGITNGFQQIMGNVIQSATSAVA
SLPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSRMAEGL
ALRDAVSSTDAVSAIEQAETRRGNDGVPWVGGSNAGGSGQPAIKVVGDVTRAGYNLVNGR
GVTDTSSIAPTSCSSLSCQTWTSPQAAVEWATRVLGEKEQRTCDACTKTETTPGVGLTPL
IQEEYDAKLQALQDLVSKAKNTTPENLREAGSASLPITRGVIEALRDEPDQHLLSQRLAS
EVALSSVLEKALLLQRTLLTGKKEPNVAANELAVESVNKESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGTRAAGSRGIYEGDPIPDRLDRLQKGNPGGNP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcgtcctgcattcaatccgttctccccccgtgtacctcgcacgaagatcgtt
ctggcgctggctggtgcgctggccttggccagcggcgtggcctggggccaactgggctac
cagacgggcggcagcgtcatcggcgatgacgtcatgtactccatcggtggcggcagcgca
gtgtccatgggacgtgccgcaggaatgcaatcgatcggcgtgggcgtgggctggaactca
aatctcgtctgcggcgacatgagcctccagaccactctgcgcaaccagctcaacggcatc
acgaacggctttcagcagatcatggggaacgtgatccagagcgccaccagcgccgtggca
tccctgcctgcgctgatcattcagcgcgccgacccgggcttgtacaacctgctcaccaat
ggcgtgctgcaagcgcggctggatttcgaccgttccaagctgacgtgccgcgcaatggcc
gagaagatggccgacacagcgggcggccagctcggctggagccggatggcagaaggtttg
gcgctgcgcgatgcggtgtcaagcacggatgcggtctcggccatcgagcaggccgaaacg
cgccgcggcaatgacggtgtgccgtgggtcgggggtagcaacgcggggggctctggtcag
cccgcgattaaggtcgtcggcgatgtcacccgcgccggctacaacctagtcaacggccgc
ggcgtgaccgatacgtcgtctatcgcaccgaccagttgtagcagcctctcgtgccagacc
tggacctcgccgcaggccgccgtcgagtgggccacgcgcgtactcggcgagaaggaacag
cgcacttgcgatgcctgcaccaaaaccgagacgacgcccggcgtaggactgacgccgctg
atccaggaagagtacgacgccaagctgcaggcgctccaggatctggtgtccaaggcgaag
aacacgacgcccgagaacctgcgcgaagctggcagtgcatcgctgcccatcacccgcggc
gtcatcgaggcgctgcgcgacgagccggaccagcacctgctgtcgcagcgcctggcgtcc
gaggtcgcgctgtcctcagtgctggagaaggcgctgctgctacagcgcacgctgctcacg
ggcaagaaagagcccaacgtcgcggccaacgagcttgcggtggagagcgtgaacaaggag
agcgatacgctcgaccgcgaaatccgcaacctcaagaccgaactggagctacggcgcgaa
ctggcgaataactcgcccatggccatcatccagcggcatggcacgcgtgcggcaggctcg
cgcggcatctacgagggcgatcccatccccgaccgtctcgaccggctccagaagggcaat
ccgggaggcaacccatga

DBGET integrated database retrieval system