KEGG   Bordetella petrii: Bpet1821Help
Entry
Bpet1821          CDS       T00637                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bpt  Bordetella petrii
Pathway
bpt00020  Citrate cycle (TCA cycle)
bpt00190  Oxidative phosphorylation
bpt00650  Butanoate metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01200  Carbon metabolism
Module
bpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpet1821 (sdhD)
   00650 Butanoate metabolism
    Bpet1821 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Bpet1821 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF4017 CybS Bap31
Motif
Other DBs
NCBI-ProteinID: CAP42160
UniProt: A9IIS8
Position
1885217..1885600
Genome map
AA seq 127 aa AA seqDB search
MAATKNYGPTRLVVGAHYGVVDFIAQRLTAVIMAVYTLVLIIGVLVMPSFSYENWKALFT
FHVYALPLGQILATLFFFALAWHAWIGVRDIWMDYVRPAGVRMLLQVLTILWLVGSIVYF
AQILWSI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccaagaactatggccccacgcgcctggtcgtgggcgcgcattacggcgtc
gtcgatttcatcgcgcagcgcctcaccgccgtcatcatggcggtgtacaccctggtgctt
atcatcggcgtgctggtcatgccgtcgttctcgtatgaaaactggaaggcgctgttcacc
ttccatgtctatgcgcttcccctgggccagatcctggccacactgttcttctttgcgctg
gcgtggcacgcctggatcggcgtgcgcgacatctggatggattacgtcaggcccgcaggc
gtgcgcatgctgctgcaggtgctgaccatcctctggctggtcgggtcgatcgtctatttc
gcgcaaatcctctggagtatctaa

DBGET integrated database retrieval system