KEGG   Bordetella petrii: Bpet2061Help
Entry
Bpet2061          CDS       T00637                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpt  Bordetella petrii
Pathway
bpt00020  Citrate cycle (TCA cycle)
bpt00640  Propanoate metabolism
bpt00660  C5-Branched dibasic acid metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01200  Carbon metabolism
Module
bpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpet2061 (sucC)
   00640 Propanoate metabolism
    Bpet2061 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Bpet2061 (sucC)
Enzymes [BR:bpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bpet2061 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAP42401
UniProt: A9IKE3
Position
2152007..2153167
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKELLKQFGVPVPRGIPAFSVDEAVAAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLARSLDDVRKLASEILGMQLVTHQTGPEGQKVNRLYIEDGADIQKEYYVSLVTDRATQK
VAIIASSEGGMDIEEVAHSTPEKIITEYIDPLTGLQAEQAKKVAESIGLSGGSADQAADV
FQKLYTCYMDTDASLVEINPLNCDSKGNIIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNKGVKAILVNIFGGIMRCDVIAEGVITACKAVNLNVPLVVRMKGTNEELGKKM
LADSGLPIISADTMAEAATRVVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtatcaaggcaaggaactgctgaagcaatttggcgtccccgtgccg
cgcgggatccccgctttttccgtcgacgaggccgtggctgccgctgaaaagctgggtggg
ccggtatgggtcgtgaaggcgcagatccacgccggtggccgtggcaagggcggtggcgtg
aagctggcgcgttcgctcgacgacgtacgcaagctggcctctgaaatcctgggcatgcaa
ctggtcacgcaccagaccggccccgaagggcagaaggtcaaccgcctgtacatcgaagac
ggcgccgacatccagaaggaatactacgtgtcgctggtcaccgaccgcgccacgcagaag
gtcgccatcatcgcttcgagcgaaggcggcatggacatcgaagaagtcgcccattcgacg
cccgagaaaatcatcaccgaatacatcgacccgctcaccggcctgcaagccgagcaggcc
aagaaggtggcggaatccatcggcctgtcgggcggctcggccgaccaggctgccgacgtg
ttccagaagctgtacacgtgctacatggacaccgacgcctcgctggtggaaatcaacccc
ctgaactgcgacagcaagggcaatatcatcgccctggacgccaagttcaacttcgattcc
aacgcgctgttccgccaccccgagatcgtcgcctaccgcgacctcgacgaagaagatccc
gctgaaatcgaagccagcaaattcgacctggcctacatccagctcgacggcaacatcggc
tgcctggtcaacggcgccggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgttggcggcggcgccacggccgagaaagtgaccgaa
gccttcaagatcatgctcaagaacaagggcgtgaaggccattctggtcaacatcttcggc
ggcatcatgcgctgcgacgtcatcgccgaaggcgtgatcaccgcgtgcaaggccgtcaac
ctgaacgtgccgctggtcgtccgcatgaagggcaccaacgaagaactgggcaagaaaatg
ctggccgactcggggctgcccatcatcagcgccgacaccatggccgaagcggccacccgc
gtcgtagccgccgtcaaataa

DBGET integrated database retrieval system