KEGG   Bordetella petrii: Bpet2204
Entry
Bpet2204          CDS       T00637                                 
Symbol
traG1
Name
(GenBank) conjugal transfer protein TraG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
bpt  Bordetella petrii
Pathway
bpt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bpet2204 (traG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet2204 (traG1)
Enzymes [BR:bpt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bpet2204 (traG1)
Secretion system [BR:bpt02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bpet2204 (traG1)
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C
Other DBs
NCBI-ProteinID: CAP42547
UniProt: A9IL69
Position
2285138..2287141
AA seq 667 aa
MQGTNVLFGQIAVVFGIVIAGVWGATQWTAAALGYQLRLGSPWFDFLGTPIYHPWKLFEW
WFFFDAYAPRIFDIGGAIAGGSGLVAVVVAIGMSIWRSRQSRLVTTYGSARWANAEDIRK
AGLTQPEGVFLGQHDRQYLRHEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKG
ENWQITAGWRSRFSHCLLFNPTDAKSAAYNPLLEVRRGAHEVRDVQNIADILVDPEGALE
KRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPASPFELTLHRMMTTPHLGDGP
HPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLIAAEHPVS
LYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLG
TATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKA
TKLRYYADANFKRRVLPPPALADGQYADAPPLRPDDWSGLAIPAVPAAPAADAADGFGAL
ADNGGPRRQPELSETVAYDPELAAPAADLALLDDDDDLPLPLPRQLDPAMQRTARLASLN
PNDGIEL
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgcaagggacgaacgtgctgttcggtcagatcgccgtggtgttcggcatcgtgatcgcc
ggagtgtggggtgccacgcaatggacagcagccgcccttggctatcagttacgccttggc
tcgccctggttcgattttcttggcacgccgatctaccacccgtggaagttgttcgagtgg
tggttcttcttcgacgcttacgcgccccgcatctttgacatcggcggagccatcgcaggc
gggagcggcttggtggcggtggtggtcgccatcggcatgtcgatatggcgctcgcgccaa
tcgcgcctggtcacgacctacggctccgcccgctgggcgaacgcggaggacattcgcaag
gcgggcctgacgcagccagagggcgtgttcctcggccagcacgatcgccagtacctgcgc
catgaaggcccggaacatgtcctgacctttgcgcccacgcgctcgggcaagggcgtcggc
cttgttgtgccgacgctgctgtcctggcccgcgtccgccgtcatccacgacatcaagggt
gagaactggcagatcaccgccggctggcgctcgcgcttctcgcactgcctgctgttcaac
cccacggatgcgaagtcggcggcctacaacccgctgctggaggtacggcgcggcgcgcat
gaagtgcgcgacgtgcagaacatcgcggacattctggtcgatcccgaaggcgcgctggag
aagcgcaaccattgggaaaagacttcgcacgcgctgctggtcggggccatcctgcatgtg
ctctacgcgggcgaagacaagacgctgcgcggcgtcgccaacttcctcagcgacccggcc
agcccgttcgagctgactttgcatcgaatgatgaccacgccgcacttgggcgacgggccg
catccggtagtcgcgtcggcggcgcgtgaagtgctcaacaagtcggacaacgagcgttcc
ggcgtgttgagcaccgccatgtcgttcctcggcctgtaccgcgatcccacggtggccgaa
gtcacctcgcgctgtgactggcgcatcgccgacctgatcgcggccgagcatccggtgtcg
ctgtacctggtggtgccgccttcggacatatcgcgcaccaagccgctcatccgcctgatc
ctcaaccagatcgggcggcggctcaccgaatcgctcgacggctccgacggcatcgaacgc
cgccacaagctgctgctgatgctcgacgagtttccggccctgggccggctcgacttcttc
gagacagccttggccttcatggcgggctacggcatccgtagcttcctcatcgcgcagtcg
ctcaaccagatcgacaaggcgtatgggcagaaccattccatcctcgacaactgccacgtc
agggtgacgttcgccaccaacgacgagcgcaccgccaagcgcatctccgagacgctgggc
actgcgaccgagctgcgcgcccagcgcaactacgcgggccatcggctcgcgccgtggctg
ggccacctcatggtgtcgcgccaggagacggcccgcccgctgctgacgccgggcgaagtc
atgcagcttccgcccgacgaggcggtggtgatggtgtccagcgtggcaccgatcaaagcc
acgaagctgcgctactacgccgacgccaatttcaagcggcgagtgctgccgccgcccgcg
ctggcggacgggcagtacgccgacgcgccgccgctgcgccccgacgactggagcggcttg
gcaatccctgccgtgcccgctgcgcctgcggccgatgcagccgacggcttcggggctttg
gccgacaacggcggcccacgccgtcagcctgagctctccgaaaccgtcgcctacgaccca
gaactggccgcgcccgcagccgacctcgcgctgctcgatgacgacgacgacctgccgctt
ccccttcctcgccagcttgatccagccatgcaacgcacggcccggctggcatcgctgaac
cccaacgacggaatcgagctatga

DBGET integrated database retrieval system