KEGG   Bordetella petrii: Bpet2207Help
Entry
Bpet2207          CDS       T00637                                 

Gene name
trbC1
Definition
(GenBank) conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
bpt  Bordetella petrii
Pathway
bpt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bpet2207 (trbC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet2207 (trbC1)
Secretion system [BR:bpt02044]
 Type IV secretion system
  Trb secretion system protein
   Bpet2207 (trbC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: CAP42550
UniProt: A9IL78
Position
2288678..2289070
Genome map
AA seq 130 aa AA seqDB search
MTQMIVPAFRVSANPALRLPIRSRLRSLARPAAQGLMLAALLLFLTGTAQAAGSSMPWEG
PLQSILESIQGPVARIVAVIIIITTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLS
FFSFSGGAVV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatgatcgttcctgctttccgtgtttctgcaaatccggctttgcgccttccc
atccggtcgcggctgcgcagcctggcccgccctgcggcacaagggctgatgctggccgcg
ctgctgctgttcctgaccggaaccgcgcaggccgccggttcttcaatgccatgggaaggc
ccgctgcaatccatcctcgaatccatccaggggccggtggcgcgcatcgtcgcggtcatc
atcatcatcaccacgggcctcgcgctggccttcggcgacacgtcgggcggattccgcaag
ctgatccagatcgtgttcggtctgtccatcgcgttcgcggcttcgagcttcttcttgtcg
ttcttcagcttctccggcggggccgtcgtatga

DBGET integrated database retrieval system