KEGG   Bordetella petrii: Bpet2209
Entry
Bpet2209          CDS       T00637                                 
Symbol
trbE1
Name
(GenBank) conjugal transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bpt  Bordetella petrii
Pathway
bpt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bpet2209 (trbE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet2209 (trbE1)
Enzymes [BR:bpt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Bpet2209 (trbE1)
Secretion system [BR:bpt02044]
 Type IV secretion system
  Trb secretion system protein
   Bpet2209 (trbE1)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 AAA_22 TraG-D_C CbiA AAA_16 TrwB_AAD_bind FtsK_SpoIIIE NACHT ABC_tran DUF87 Zot T2SSE RsgA_GTPase
Other DBs
NCBI-ProteinID: CAP42552
UniProt: A9IL82
Position
2289352..2291817
AA seq 821 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRAAADYPHSEFPEPLSWLVDEERRATFEESGNHFESGYH
LTLVYLPPEESRARAAKMLYENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEIAWLDD
SQTLTYLHSTISTRRYRVGVPEVPFHIDALLTDSPLVGGLAPMLGDRHLRVVSVRGFPTS
TWPGILDDLNRLGFGYRWSTRFLCLDKSEAERELGRLRRQWFAKRKNVIALLRETIFQQE
SPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDDDAGAADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSLPGNAYANVRQPIISTLNLAHMMPVSAVWAGPERNAHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGR
SMRATILGLGGEHYDLGMDGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVAVGPDEKA
AIWSALGSLAGAPVEQRTMTGLSVLLQSNALRQALAPYVLGGAHGKLLDADHDRLGMANV
QCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLDDPVFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPATLAFAGASTPQDQRAIDEVLGRVPPGAG
TPGFAGAWLRHRGLDWAADLLPSFPGLAPDSLADQPLENLP
NT seq 2466 nt   +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgccaacggcccgcgctgctcgccgactggctgccctgg
gccgggttggtcgcgcccggtgtcgtcttgaacaaggacggcagtttccagcgcacggcc
cggtttcgcgggcctgacctcgacagcgccacgcaaggcgagctgatcgccacgtcggcc
cgcttgaataacgcgctgcgccggctgggttcgggctgggcgctgttcatcgaggccgag
cgccgcgccgccgccgattacccgcactcggagtttcccgagccgctttcgtggctggtg
gacgaagaacgccgggccaccttcgaggaatcgggcaatcacttcgagagcggctatcac
ctgacgctggtgtatctgccgcccgaggaatcgcgcgcccgtgccgccaagatgctctac
gagaacacgccgacgaatggcgtggactggcgcgagcggctgcaagccttcgtcgcggaa
acggatcgggtctttgacctgctcgatggcgtcatgccggaaatcgcctggctggacgac
agccagacgctgacctatctgcactcgaccatctcgacacgacgctatcgcgtcggcgtt
cccgaggtgccgttccacatcgacgcgctgctgaccgactcgccgctggtcggtggcctg
gcccccatgcttggcgacaggcacctgcgcgtggtgtcggtacgcggtttcccgacctcg
acctggccggggattctggacgacctcaaccgcctgggatttgggtatcgctggagtacg
cgctttctgtgcctcgacaaatccgaggcggaacgggaattggggcgcctgcgccgccag
tggttcgccaagcgcaagaacgtcatcgcgctgctgcgcgaaaccatcttccagcaggaa
agcccgctggtcgataccgacgcgaacaacaaggccgccgatgccgacgccgccttgcag
gagctgggcagcgatcaagtcgccttcggctacctgacggcgaccgtcaccgtcatggac
gacgacgccggcgcagccgacgagaagctgcgcatggtggagcgggtgattcaggggcgt
ggcttcgtcaccatccccgaaacgctcaatgccgtggatgcgtggctgtcctcgctcccc
ggcaatgcctatgcgaatgtccggcagccgatcatctcgaccctcaatctggcgcacatg
atgccggtgtccgccgtgtgggccggccccgagcgcaatgcccacctcgacggcccgccg
ctaatcgtcacccgcaccgatggcgcgacgccgttccggctggtgacgcacatcggcgac
gtgggccacacgctggtcgccggcccgactggcatgggcaagtcggtcttgctcgccacg
ctggcgatgcagtttcgccgttatcgcggctcgcgcatcttcgcgttcgacatggggcgc
tccatgcgcgcgaccatcctcgggctgggcggcgagcactacgacctgggcatggatggc
gaaatcgcctttcagcccttggctcgcattgaccgcgagggctaccgcacctgggccgcc
gaatggatcgaaggccgcttgctgcacgaaggcgtggcggtcggccccgacgagaaggct
gctatctggtcggcactcggcagccttgccggtgcgccggtggagcagcgcacgatgacc
gggctgtccgtgctgttgcagagcaatgcgctgcgccaggcgctcgcgccctatgtgctg
ggcggcgcgcacgggaagctgctggacgccgatcacgaccggctaggcatggccaacgtg
cagtgcttcgagatggaggagctgatgcacagcaaggccgccgtcatggccgtgctgcat
tacctctttgcgcgctttgacgaacgcttcgacggtgcgcccacgctgttgatcctcgat
gaagcctggttgtttctcgatgacccggtgttcgccgcgcgcatccgccagtggctcaag
acgctgcgcaagaaaaacgtgtcggtgatcttcgccacgcagagtcttgccgacatcaag
gattcgagcatcgcgcccgcgatcatcgaaagctgcgcgagccgcatcttcctgccgaac
ccacaggcgaccgaaccgcagattcgcacgatctacgagggcttcgggttgaactcgcgc
cagatcgagatcgtcgccactgcgcagcccaagcgcgactactactaccaatcccgcctc
ggcaaccgcctgttcgacctcgacctggggccggcgacgctggcttttgcgggcgcttcc
acgccgcaagaccagcgcgccattgacgaagttcttggccgcgtgccgccgggcgccggc
acgcccggcttcgcgggcgcctggctgcgccatcgcggcctcgattgggcggctgacctg
ctgccctcgttccccggcctcgcgccggattccctcgctgaccaaccactggagaacttg
ccatga

DBGET integrated database retrieval system