KEGG   Bordetella petrii: Bpet2214Help
Entry
Bpet2214          CDS       T00637                                 

Gene name
trbG1
Definition
(GenBank) conjugal transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
bpt  Bordetella petrii
Pathway
bpt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bpet2214 (trbG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet2214 (trbG1)
Secretion system [BR:bpt02044]
 Type IV secretion system
  Trb secretion system protein
   Bpet2214 (trbG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: CAP42557
UniProt: A9IL96
Position
2294916..2295908
Genome map
AA seq 330 aa AA seqDB search
MNDLFRKSALPLIVLTLAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMP
AQLMPVPEAEDAKPTPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQVYA
AVGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGNGADLRVNVLVKPIRSGLKTNLVIT
TSRRTYLLELTSTDKTWMASVSWEYPRDRMLALQRQAQAASAAAPVDSGLSLENLRFRYA
ISGSNPQWKPLRAFDDGQKVYIQFPAGIAQGDLPPLFVIGAEGDGQLVNYRFRSPYYIVD
RLFGAAELRLGGDKGDVVRIERTDGVARRN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcttttccgtaaatccgccttgccgttgatcgtgctcaccctcgcgggctgc
gccacgcagggcaagccgccgccgaccatctcgctcgatgagccggtgcaggcccagccg
ctgcccgagccgcccgcgccggtggaggtggtggccgtgcccgaggtgctgccgatgccg
gcgcagttgatgccagttcccgaggccgaggatgccaagcccacacccgagccggccgac
gagaaggtgcgcgtttcgcgggccaatgccgaggcgcgtgtcgcgcccacgcgcgagggc
tacgtcaacgcgattcaggtgtggccgttcaccgatggcgcgctctaccaagtctatgca
gccgtgggccgcgtgaccgtggtttcgctccagccgggcgaggagctggtgacagtggcc
gccggcgataccgtgcgctggatcgtgggcgacacgtctagcggcaacggtgccgatttg
cgcgtcaacgtgctggtgaagccgatccgctcgggcctcaagaccaatctggtcatcacc
accagccgcaggacgtacttgctggaactgacttccacggacaagacgtggatggcgtcc
gtttcgtgggagtacccgcgcgaccggatgctggccttgcagcgccaggcgcaagcggcc
agcgccgccgcgccggtcgatagcggcctgtcgctggagaacctgcgctttcgctacgcg
atcagcggcagcaatccgcagtggaagccgctgcgcgccttcgacgacgggcagaaggtc
tatatccagtttcccgctggcatcgcgcaaggcgacctgccgccgctgttcgtgatcggg
gccgaaggcgatgggcaattggtgaactaccgcttccgctcgccgtactacatcgtggat
cgcctctttggtgcggcggaactgcgcctgggcggcgacaagggcgacgtggtgcggatc
gagcgcacggatggcgtggcacggaggaactga

DBGET integrated database retrieval system