KEGG   Bordetella petrii: Bpet2215
Entry
Bpet2215          CDS       T00637                                 
Symbol
trbI1
Name
(GenBank) conjugal transfer protein TrbI
  KO
K20533  type IV secretion system protein TrbI
Organism
bpt  Bordetella petrii
Pathway
bpt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bpet2215 (trbI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet2215 (trbI1)
Secretion system [BR:bpt02044]
 Type IV secretion system
  Trb secretion system protein
   Bpet2215 (trbI1)
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: CAP42558
UniProt: A9IL99
Position
2295911..2297191
AA seq 426 aa
MSQDDTPDLATPQAGKVAPETVALRAQPRAVTRLNRRTLAVLVGSLSVAVLGATIWSLQP
QRRGAGEQTELYNVDRVSKSEGLDGLPADYSKLPQKVPELGPPLPGDLGPAIVNSQQPAV
AAYAAPGHDPNDALRKEAEAAAASSVFFRSAGQGQAAATTTMAQTAPGVPGAANTLAAFD
PLAAGPASAAAQLAAPTAARSRQDQNEAFLQSGSTETRNSGHLALPASPYQVMAGTVIAG
ALVTGIKSDLPGDVIATVTEPVYDSATGKFLLIPQGSRILGRYNSRVSHGQSRVQVVWNR
VILPDTSSLTLDNLIGTDPAGYSGLEDDVDWHWDRVVAGAVLTTLLGVGAELAAPENRQD
GNRIVIAGRDSAQDSINQVGQEITRRNMDIQPTLTIRPGLPVRVIVNRDLVLRPYQPLFF
NRGASQ
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagccaggacgacactcccgacctcgccacgccgcaggcaggcaaggtcgcgcccgag
acggtggcgcttcgtgcccagccgcgtgctgtgacccggttgaaccggcgcacgctggcc
gtcctcgtcggtagcctgtcggtcgccgtgctcggggccacgatctggtcactgcaaccg
cagcggcgtggcgcgggcgagcagaccgagctttacaacgtcgatcgcgtctcgaagtcc
gaagggctggacggcctgccggccgactactcgaagctgccgcagaaggtgcccgagctg
gggccgccactgccgggcgatcttggcccggccatcgtgaactcgcagcagccggccgtg
gccgcttacgcggcccccggccacgatccgaacgatgccttgcgcaaggaagcggaagcc
gcagcggcttcgtcggtgttcttccgctcggccggccagggtcaggccgccgccacgacc
acgatggcgcagacggcgccgggtgtgcccggtgctgccaacacgctcgcggccttcgat
ccgctcgcggctgggccagcctcggcggcggcccagcttgccgccccgactgcggcacgg
agtcggcaagaccagaacgaggcattcctgcaaagcggctctacggaaacccgcaattcc
ggccatctggcactgccggcatcgccgtatcaggtcatggccgggacggtgatcgcgggc
gcgctggtgacaggcatcaagtcggacttgccgggcgacgtgatcgccacggtgacggag
ccggtctatgactcggccacgggcaagtttctgctgatcccgcagggctcgcgcatcctc
gggcgctacaacagccgggtcagccacgggcagagccgcgtgcaggtggtgtggaatcgg
gtcatcctgcccgacacgtcttcgctgacactcgacaacctcatcggcaccgacccggcc
ggttactccggcctggaggatgacgtggactggcattgggatcgcgtcgtcgcgggcgcg
gtgctgacgacgttgctgggcgtcggtgccgagctggccgcgcccgagaaccgccaggac
ggcaaccgcatcgtcatcgccgggcgcgacagcgcccaggacagcatcaatcaggtcggc
caggagattacccggcgcaacatggacatccagccgacgctgaccatcaggcccggcctg
ccggttcgcgtcatcgtcaaccgggatctggtgctgcggccctaccagccgctgttcttc
aaccggggggcttcgcaatga

DBGET integrated database retrieval system