KEGG   Bordetella petrii: Bpet2446
Entry
Bpet2446          CDS       T00637                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bpt  Bordetella petrii
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet2446
Secretion system [BR:bpt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bpet2446
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAP42788
UniProt: A9IN54
Position
2564095..2564613
AA seq 172 aa
MANDGSVAPKERVNIVYKPATGDAQEQVELPLKQLVLGDFTLQESDTPLDERKPIQVDKD
NFNDVLKAQGLSVTMAVPNRLSEGESDESLPVTLKFENIRDFEPDALVEQVPELRQLIEL
REALKSLKGPLGNLPDFRKKLQALIQDEGARERLLSELGVQSAGPESDQSKE
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaatgatggatccgtagccccgaaagaacgtgtcaacatcgtctacaagccggcc
accggcgacgcgcaggagcaggtcgaactgccgttgaagcaactcgtgctgggcgacttc
acgctgcaggaatcagataccccgctcgacgagcgcaagcccattcaggtcgacaaggac
aacttcaacgacgtgctcaaggcccagggcctgagcgtgaccatggcggtgcccaaccgc
ctgtccgaaggcgaaagcgacgaatcactgccggtcaccctgaaattcgagaacatccgc
gatttcgagcccgacgcgctggtcgagcaagtgcccgagctgcgccagttgatcgagctg
cgcgaagcgcttaagtccctgaaaggcccgctgggcaatcttcccgatttccgcaagaag
ctgcaggcgctcattcaagatgaaggcgcgcgcgaacgcttgctgtccgaattgggtgtg
caatcggccggccccgagtccgaccagtccaaggagtaa

DBGET integrated database retrieval system