KEGG   Bordetella petrii: Bpet2551Help
Entry
Bpet2551          CDS       T00637                                 

Gene name
gcp
Definition
(GenBank) O-sialoglycoprotein endopeptidase
  KO
K01409  N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
bpt  Bordetella petrii
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpt03016]
    Bpet2551 (gcp)
Enzymes [BR:bpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     Bpet2551 (gcp)
Transfer RNA biogenesis [BR:bpt03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    Bpet2551 (gcp)
 Prokaryotic type
    Bpet2551 (gcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Carbam_trans_N NBD_C baeRF_family10 AnmK RibD_C
Motif
Other DBs
NCBI-ProteinID: CAP42893
UniProt: A9IP11
Position
complement(2668450..2669496)
Genome map
AA seq 348 aa AA seqDB search
MIILGFESSCDETGVAAVSTERGLLAHALHTQIAMHQEYGGVVPELASRDHIRRAVPLAR
QVLAEAGLGLQDVDAVAYTAGPGLAGALLVGASVAQAFAWARGLPAIPIHHLEGHLLSPL
LDDPRPDFPFVALLVSGGHTQLMRVDGVGRYALLGETLDDAAGEAFDKSAKLMGLGYPGG
PALSRLAASGDPRRYALPRPMLHSGDLDFSFSGLKTAVLTRVKEAERDGGLDDAARADLA
AATQAAIVEVLVAKAVRALKQTGLKRLVVAGGVGANQLLRELLAQALRPLGARAYFPPLA
LCTDNGAMIAFAAAERVKAGLASLQAGQHAFTVRPRWDLADICAGTPA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatcattcttggcttcgaaagttcgtgcgacgagaccggcgtggccgccgtcagcacc
gaacgcggcctgcttgcgcacgccctgcatacccagatcgccatgcaccaggagtacggc
ggcgtggtgcccgaactcgcctcgcgcgaccacatccgccgcgcggtgccgttggcgcgc
caggtgctggcagaggcgggcctgggcctgcaggatgtcgacgcggtggcttataccgcc
gggccaggcctggccggggcgctgctggtgggcgccagcgtggcgcaggcgtttgcctgg
gcgcgcgggctgccggccattcccattcaccacctcgaaggccacctgctgtcgccgctg
ctcgacgaccctcgccccgatttcccgttcgtggcgctgttggtgtccggagggcatacg
caactgatgcgggtcgatggagtagggcgctatgccttgctgggcgaaactctcgacgac
gccgccggcgaggctttcgacaaatcggccaagctgatgggcctgggctatccgggcggt
ccggcgctgtcgcgcctggcggccagcggcgatccgcggcgctacgcgctgcctcgcccc
atgctgcacagcggcgacctcgacttcagcttcagtggcctgaaaaccgcggtgctgacg
cgcgtaaaagaagccgagcgcgatggcggcctggacgacgccgcgcgcgccgacctggcc
gccgccacccaggcggccatcgtcgaagtgctggtggccaaggccgtacgggcgctcaag
caaaccgggctgaaacggctggtggtggcgggcggcgtgggcgccaaccagttgctgcgc
gaactgctcgcgcaggcgctgcggccgctgggcgcgcgagcctatttcccgccgttggcg
ctgtgcaccgacaatggcgccatgatcgcgttcgcggctgccgagcgggtcaaggccggg
ttggcgtcgctgcaggccggccagcatgcgttcacggtcaggccgcgctgggatcttgcc
gacatctgcgcgggcacgccagcctag

DBGET integrated database retrieval system