KEGG   Bordetella petrii: Bpet2746Help
Entry
Bpet2746          CDS       T00637                                 

Gene name
thrC
Definition
(GenBank) thrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00260  Glycine, serine and threonine metabolism
bpt00750  Vitamin B6 metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01230  Biosynthesis of amino acids
Module
bpt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpet2746 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bpet2746 (thrC)
Enzymes [BR:bpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bpet2746 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAP43088
UniProt: A9IQR3
Position
complement(2882567..2883976)
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGGMAPQAFSDILLEGLAPDGGLAVPETLPQISADTLESWRGLSYADLAFEVLS
RFATDIPADDLRRLTHAAYRPGIFSSEDIVPLRALDDGMHLLGLSEGPTLAFKDMAMQFL
GQVFEYVLTRRGATLNILGATSGDTGSAAEYALRGKQGVAVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVRGVFDEAQDIVKALAGDLDFKTRYRIGAVNSINWARIAAQVVYYFHGWL
RATSAAGQQVSFAVPSGNFGNILSGHIARAMGLPVRRLVLATNENNVLEEFFRTGIYRPR
GAEQTYATSSPSMDISRASNFERFVFDLTGRDPRRVKALWADLARDGYFDLASLKPGFES
QYGFVAGTSTHADRLAVIRATYDATGVLVDPHTADGVKVAREFVEPGVPMLVLETALPAK
FSDTIEEALGRPVTPPPALAGLESLPQRVEVMDCDAQLVRRYIEANAKV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatttctacccgcggcggcatggccccgcaagcattcagcgacatcctgctc
gaaggcctggcccccgacggcggcctggccgtacccgaaaccctgccgcagatttcggcc
gatacgctcgaaagctggcgcggcctgtcgtatgccgacctggctttcgaagtgctgtcg
cgctttgccaccgatatcccggccgacgacctgcgccgcctgacgcacgcggcctaccgg
cctggcatcttcagcagcgaagacatcgtgccgctgcgggcgctcgatgacgggatgcat
ctgttgggcctgtcggaaggcccgacgctggccttcaaagacatggccatgcagttcctg
ggccaggttttcgagtatgtgctgaccaggcgcggcgccacgctgaacatcctgggcgcc
acgtcgggcgataccgggtcggctgccgaatacgcgctgcgcggcaagcagggcgtggcg
gtgttcatgctgtcgccgcatggccgcatgagcgcctttcagcgcgcccagatgtactcg
ctgcaagacgagaacatccacaacatcgccgtgcgcggcgtgttcgacgaggcccaggat
atcgtcaaggcgctggctggcgatctcgatttcaagacccgctatcgcattggcgcggtg
aattccatcaactgggcgcgcatcgccgcccaggtggtgtattacttccatggctggctg
cgcgccacctcggctgccggacagcaggtgtcgttcgccgtgccctcgggcaatttcggc
aatatcttgtcggggcacatcgcgcgcgccatgggcctgcccgtgcggcgcctggtgctg
gccaccaacgagaacaacgtgctggaagagttcttccgcaccggcatctaccgcccgcgc
ggcgccgagcaaacctacgcgacctccagcccgtcgatggatatctcgcgggcctcgaat
ttcgagcgcttcgtcttcgatctcaccggtcgcgacccgcggcgcgtcaaggcgctatgg
gcggacctcgcgcgcgacggctacttcgatctggcctccctgaagccgggcttcgaatcg
cagtacggcttcgtggccggcaccagcacgcacgccgaccgcctggccgtgattcgcgcc
acctacgacgccaccggcgtgctggtcgacccgcacactgcggacggcgtgaaggtcgcc
cgcgagttcgtcgagccgggcgtgcccatgctggtgctggaaacggcgctgccggcaaaa
ttttccgacaccatcgaagaggccctgggccggccggtaacgccgccaccggccctggca
ggcctggagtcgctgccgcagcgcgtcgaggtcatggattgcgacgcacagttggtacgg
cgctacatcgaggccaatgccaaagtgtaa

DBGET integrated database retrieval system