KEGG   Bordetella petrii: Bpet3410Help
Entry
Bpet3410          CDS       T00637                                 

Gene name
fadA7
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpt  Bordetella petrii
Pathway
bpt00071  Fatty acid degradation
bpt00072  Synthesis and degradation of ketone bodies
bpt00280  Valine, leucine and isoleucine degradation
bpt00310  Lysine degradation
bpt00362  Benzoate degradation
bpt00380  Tryptophan metabolism
bpt00620  Pyruvate metabolism
bpt00630  Glyoxylate and dicarboxylate metabolism
bpt00640  Propanoate metabolism
bpt00650  Butanoate metabolism
bpt00900  Terpenoid backbone biosynthesis
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01200  Carbon metabolism
bpt01212  Fatty acid metabolism
bpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpet3410 (fadA7)
   00630 Glyoxylate and dicarboxylate metabolism
    Bpet3410 (fadA7)
   00640 Propanoate metabolism
    Bpet3410 (fadA7)
   00650 Butanoate metabolism
    Bpet3410 (fadA7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bpet3410 (fadA7)
   00072 Synthesis and degradation of ketone bodies
    Bpet3410 (fadA7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet3410 (fadA7)
   00310 Lysine degradation
    Bpet3410 (fadA7)
   00380 Tryptophan metabolism
    Bpet3410 (fadA7)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpet3410 (fadA7)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet3410 (fadA7)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bpet3410 (fadA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpt04147]
    Bpet3410 (fadA7)
Enzymes [BR:bpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bpet3410 (fadA7)
Exosome [BR:bpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bpet3410 (fadA7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt bPH_6 ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAP43753
UniProt: A9HXD4
Position
3595406..3596695
Genome map
AA seq 429 aa AA seqDB search
MAHAPIYVVDGARSPFLKARNAPGPFSAADLAVQAGRALLLRQPFAPGDLDEVIIGCAAP
SPDEVNIGRVIALRLGCGNRVPGWTVMRNCASGMQALDSAIANIRTGRSSLVLAGGVDAL
SRAPLLVSDDMTRWLARWSAARGADARLAALRAFPWRGLAPVIGLVKGLTDPVVGLSMGQ
TAENLATRFGIDRTAMDAYAARSHARALAARAAGAFGEIAPLIDTRGTLYADDDGVREDS
TPERLARLRPVFDKPWGNITAGNSSQVTDGAALLVLASEDAVRRWNLRPLGRIVDSQWAG
LDPAQMGLGPVHAATPILQRHGLALGDLDLWEINEAFAAQVLACLAAWEDESYCREHLGT
GALGSLDQNRLNVDGGAIALGHPVGASGARIVLHLLQALRARGLRRGMAAICIGGGQGGA
MLVETEAQP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgcccccatctacgtcgtggacggtgcgcgcagccccttcctgaaggcgcgc
aacgcgcccggtccgttctcggccgccgacctggcggtgcaggccgggcgcgcgctgctg
ttgcgccagcccttcgcgcccggcgacctggacgaggtcatcatcggctgcgccgcgccc
tcgcccgatgaagtcaatatcggccgcgtcatcgctttgcggctgggctgcggcaaccgc
gtgcccggctggaccgtcatgcgcaactgcgcctcgggcatgcaggcgctggattccgcc
atcgccaacattcgcaccgggcgctcgtcgctggtgctggcgggcggcgtggacgccttg
tcgcgcgcgcccctgctggtgtccgacgacatgacccgctggctggcgcgctggagcgcg
gcacgcggcgcggacgcccgcctggcggcgctgcgcgccttcccctggcgcggcctggcg
ccggtcatcggcctggtcaaggggctgaccgatccggtagtgggcctgtccatggggcag
acggccgaaaacctggccacccgcttcggcatcgatcgcaccgccatggacgcctacgcc
gcgcgcagccacgcgcgcgcgctggcggcccgcgcggcgggcgcattcggcgagatcgcg
ccgctgatcgacacgcgcggcacgctgtatgcggacgacgacggcgtgcgcgaggactcc
acgcccgaacgcctggccaggttgcggcccgtgttcgacaagccgtggggcaacatcacg
gccggcaacagctcgcaggtaaccgacggcgccgcgctgctggtgctcgcgtccgaagac
gccgtgcggcgctggaacctgcgcccgctggggcgcatcgtcgactcgcaatgggcaggc
ctggacccggcccagatgggactgggcccggtgcacgcggccacgcccatcctgcaacgg
cacggcctggctttgggcgacctggacttgtgggaaatcaacgaggccttcgccgcgcaa
gtgctggcctgcctggccgcatgggaagatgaatcgtattgccgcgaacacctgggcacc
ggcgccctgggctcgctcgaccaaaatcgtctcaacgtcgatggcggcgccatcgccctg
gggcatccggtcggcgcctccggcgcgcgcatcgtgctgcatctgctgcaggcgctacgg
gcgcgcggcttgcggcgcggcatggcggccatctgcatcggcggaggccaaggcggcgca
atgctcgtcgaaacggaggcccaaccatga

DBGET integrated database retrieval system