KEGG   Bordetella petrii: Bpet3737
Entry
Bpet3737          CDS       T00637                                 

Definition
(GenBank) 2-hydroxy-6-phenylhexa-2,4-dienoic acid hydrolase
  KO
K10702  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [EC:3.7.1.25]
Organism
bpt  Bordetella petrii
Pathway
bpt00622  Xylene degradation
bpt01100  Metabolic pathways
bpt01120  Microbial metabolism in diverse environments
bpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    Bpet3737
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.25  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
     Bpet3737
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_4 Ndr BAAT_C
Other DBs
NCBI-ProteinID: CAP44080
UniProt: A9I2N6
Position
3946637..3947467
AA seq 276 aa
MTNANAEVGRMVRAGSIDTNLHDVGAGKPVLLVHGSGPGVTAWANWRTVMPELSRRRRVI
APDMVGFGFTERPQGIRYGLDTWVEHLVGILDAMELDRVDFVGNSFGGGLSLAFAIRFPH
RVRRLVLMGSAGVSFKLTDGLDAVWGYEPSVPNMRKVMDYFAYDRSLVSDELAELRYGAS
IRPGFQEAFASMFPAPRQRWVDALASTDQDIRAIRHETLILHGRDDRVVPLETSLRLNQL
IEPSQLHVFGRCGHWVQIEQNQGFIRLVNDFLDTED
NT seq 831 nt   +upstreamnt  +downstreamnt
atgacgaatgcaaacgcagaagtcggtcgcatggtgcgagccggcagcatcgacaccaat
cttcatgacgtcggcgccggcaagccggtcctgctcgttcatggttcaggccctggcgtg
accgcctgggcgaactggagaacggtcatgcccgagttgtcccggcgccggcgcgtcatc
gcaccggacatggtgggcttcggcttcacggagcggccgcaagggattcgctatggcctc
gatacgtgggtcgagcatctggtcgggattcttgacgccatggaactcgaccgtgtcgat
ttcgtggggaattcgttcggaggcggcttgtctctggcctttgccatccggtttccgcac
cgggtccgccggctggtgctgatgggatcagcgggcgtgagcttcaagctcaccgatggg
ctggacgccgtgtggggctatgagccgtccgtgcccaacatgcgcaaggtcatggactac
tttgcctacgaccgaagcctcgtttccgatgagctggcggaactgcgctacggcgcgagc
atcaggcccggcttccaggaggccttcgcgtccatgttccccgccccgcggcagcgatgg
gtggatgcgctggccagcaccgatcaggacatccgggcgatccggcatgaaacgctgatc
ttgcatggccgtgacgaccgcgtggttccccttgaaacgtcgttgcgcctgaaccagctg
atcgagccctcgcagttgcatgtctttggaagatgtggccattgggtgcagatcgagcaa
aaccaaggcttcatccgtttggtcaacgacttcctcgacacggaggactga

DBGET integrated database retrieval system