KEGG   Bordetella petrii: Bpet4003Help
Entry
Bpet4003          CDS       T00637                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bpt  Bordetella petrii
Pathway
bpt00900  Terpenoid backbone biosynthesis
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpet4003 (ispE)
Enzymes [BR:bpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bpet4003 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAP44351
UniProt: A9I6X3
Position
complement(4227018..4227947)
Genome map
AA seq 309 aa AA seqDB search
MLYDVPAPAKLNLFLHVVGRRPDGYHLLQTVFGFIDLCDTLHFEARADGRIERAADLPGV
PPEHDLTLRAARALQQATGTRQGAVISLEKRIPQGGGLGGGSSDAATTLIALNRLWGTGL
SRSDLMALALPLGADVPVFVYGQPAFAEGVGEQLAPVALPPAVYLVVQPDASVPTAGIFA
DPDLTRDTPSVTIADFLASQDFDVAGSAGGGRDLFGRNDLEPVVYRRYPEVLGAAQWLSG
RGIHARMSGSGACLFARYATMQQAVLAQQEITATMRVAGETAGHTQPGFRLVRACPGLAE
HPLRNWIAR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgacgttcccgcgccggccaagctgaacctgttcctgcatgtggtggggcgc
cggcccgacggctaccatctgctgcagaccgtgttcggcttcatcgacttgtgcgacacc
ctgcatttcgaggcgcgggccgatggccgcatcgagcgcgccgccgacctgcctggcgtg
ccgcccgaacacgacctgaccctgcgcgccgcgcgcgcgctgcagcaggccaccggcacc
cgccagggcgccgtcatcagcctggaaaaacgcattccgcaagggggcgggctgggcggc
ggctccagcgatgccgccactaccctgatcgccctgaaccgcctgtggggcacggggctg
tcgcgcagcgacctgatggccctggcgctgcccctgggcgccgacgtgccggtgttcgtg
tatggccagccggcgtttgccgaaggcgtgggcgagcaactggccccggtggcgctgccg
ccggccgtgtacctggtcgtgcaacccgacgccagcgtgcccacggctggcatttttgcc
gaccccgatttgacacgtgacacaccttcagtcacaatagcggactttcttgcttcgcaa
gatttcgatgtggccggcagtgccggcggcggtcgggatctttttggcagaaacgacttg
gaaccggtggtctaccggcgttaccctgaagttctcggggcggcgcagtggctgtcgggg
cgtggcatacacgcccgcatgtcggggtctggcgcgtgtttgttcgcccggtacgccacc
atgcagcaagccgttttggcgcagcaggaaattaccgctacaatgcgcgtcgccggtgaa
actgccggccacacgcagccagggttccggttagtgcgggcatgtcccgggttggccgag
catccgttgcggaactggatcgcaagatag

DBGET integrated database retrieval system