KEGG   Bordetella petrii: Bpet4112Help
Entry
Bpet4112          CDS       T00637                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bpt  Bordetella petrii
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpt02044]
    Bpet4112
Secretion system [BR:bpt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bpet4112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: CAP44460
UniProt: A9I7X4
Position
complement(4350645..4352549)
Genome map
AA seq 634 aa AA seqDB search
MDARLLDYYNRELVYMREMGAEFAQMYPKVAGRLGMHGTEVADPYVERLLEGFSFLTARI
HLKMDAEFPRFSQRLLEVVYPNYLAPTPAMAVVQFSPSMNEGTLARGFDLPRGTLLRGRV
PRGEQTSCEFMTGHAVRLWPLRVAEAEFTGPPPDLPLTRLGLGGRNGRVLSALRMRIEVC
GGVRLEDMDLDQLVFHLAGQDLQMQRLLEIIMGHTVAVLGHDSARPVTWINKLAPTSVRH
EGFDDEQALLPADSRVFQGYRLLQEYFAFPRRYLFFSLNDLKRGLRTPALAGGERRETRS
FDLTMLFSTAAPELEGAIAAEHLALHCAPVINLFPKRADRIAVTPRTNEYHLVVDRTRPL
DYEVFGVTRVVGHASAERPEQEFRSFYGTLGSDPDDYGAYYSLRREPRLLSDHAQRNGTR
TGYTGSEVFVSLVDRHEAPFSGQLRHLTLETLCTNRDLAMLLPLGTETDFTLRVSAPVGA
VKVLHGPTRPHTALAENAATWHLISHLGLNYLSLIDLDAEQGAQTLREMLHVYGNLADPV
VRKHIGGVRHVQAEPMHHRLPVPGPIVYGRGVRIGLQVDETAFSGISPYLFGAVLEQFFA
RHVSLNMMSELVLSTLQRGEIARWKPRMGARPAV
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcgcctgctcgactactacaaccgcgagctggtgtacatgcgcgagatgggc
gcggagttcgcccagatgtaccccaaggtggcgggccggttgggcatgcacggcaccgag
gtggccgacccctacgtcgagcgcctgctggaagggttcagtttcctgactgcgcgcatc
cacctgaagatggatgcggaatttccccgcttctcgcaacgcctgctggaagtggtgtac
cccaattatcttgcgcccacgccggccatggcggtggtgcagttttcgcccagcatgaat
gagggcacgctggcgcgcggtttcgacctgccgcgcggcacgctgttgcgcggcagggtg
ccgcgcggcgaacagacgtcctgcgagttcatgaccgggcatgcggtgcggctgtggcct
ttgcgcgtggccgaggccgagttcaccggacctccgcccgacctgccgttgacccggctg
ggcctgggcggccgtaacggccgggtgctgagcgcgctgcgcatgcgcatcgaggtgtgc
ggcggcgtgcggctggaagacatggatctcgaccagctggtcttccatctggcagggcag
gacctgcagatgcagcgcctgctggagatcatcatggggcatacggttgcggtgctgggc
cacgacagcgcgcgaccggtgacttggatcaacaagcttgcgcccaccagcgtgcgccat
gaagggttcgacgacgagcaggccctgttgccggccgactcgcgcgtcttccagggctac
cgcctgttgcaggaatattttgcttttccgcgccgctatttattcttcagcctgaacgac
ctgaagcgcgggctgcgcacgccggcgctggccggcggcgagcgccgtgagacgcgctcg
ttcgatttgacgatgctgttctcgaccgccgcgccggaactggaaggggcgattgcggcc
gagcacctggcgctgcactgcgcgccggtgatcaatttgtttccgaagcgcgccgaccgt
atcgcggtgacgccgcgcaccaatgaatatcatctggtggtcgaccgcacacggccgctg
gattatgaggtgttcggcgtgacgcgggtggtgggccatgcctcggccgaacgccccgag
caggagttccgctcgttctacggcacgctgggcagcgatcccgacgattacggcgcctat
tattcgctgcgccgcgagccgcggctattgtcggaccacgcccagcgcaacggcacccgc
accggctatacgggcagcgaggtcttcgtctcgctggtggatcgccatgaagcgccgttc
tcgggccagctgcgccacttgacgctggagacgctgtgcaccaaccgcgatctggcgatg
ctgctgccgctgggcaccgagaccgacttcacgttgcgggtgtcggcgccagtgggcgcg
gtgaaggtgctgcacggcccgacacggccgcatacggcgctggccgagaatgccgccacc
tggcacctgatcagccacctgggcctgaactacctgagcctgatcgacctggatgccgag
cagggcgcacagacgctgcgcgagatgctgcatgtatacggcaacctggccgatccggtg
gtgcgcaagcatatcgggggtgtacggcatgtgcaggccgaacccatgcaccaccgcctg
ccggtgcccggccctattgtgtacgggcgcggagtgcgcattggcctgcaggtcgatgaa
acggcgttttcgggcatcagtccgtacctgttcggcgcggtgctcgaacagttttttgcg
cgccatgtgtcactgaacatgatgtcggaactggtgctgtctaccttgcagcgcggcgaa
atcgcccgctggaaaccccgcatgggcgcgcgccccgcggtttag

DBGET integrated database retrieval system