KEGG   Bordetella petrii: Bpet4267Help
Entry
Bpet4267          CDS       T00637                                 

Definition
(GenBank) putative exported protein
Organism
bpt  Bordetella petrii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mod_r ZapB UPF0242 Macoilin Pex19 FUSC MAD YabA
Motif
Other DBs
NCBI-ProteinID: CAP44616
UniProt: A9IAQ3
Position
complement(4528123..4529532)
Genome map
AA seq 469 aa AA seqDB search
MRSNGLLKWLLIPVALLVLSVAIRLFSGGGASAPPVADGGGRLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNRSQREENQRLRQRENAIDQRISSALESERSNLRRDQQ
QAASARQQTEGLLADLQQRLDSIGGRGGGHADLPVGLGLRDGDEAGMEGGMRWVEPDDAK
QSDGRGRSNGGISFPTSFGSAQSTLETTAQTVANAGARAAGVKSPTPVYTVPTNSTLMGS
VAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLSCVR
GQVRSITFVFHDGTIRTIPEDREGNQQNNQQRDGLGWISDPHGIPCVSGERRSNAQQYLG
TQALITAAGAGVASLIESDSGRASYVGADGSIGSVGISGQEAVGRILASGVQDMSSWVNK
LYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtaacggactcctgaagtggctgctgatccccgtggccctgctggtgctgtct
gtcgccatccggctgttttccggtggcggtgcgtcggcaccgcctgtcgcggatggcggc
ggcaggcttacgccggaagaaatgaaggcgctgggcatcgagggtgacaccccgcgcgac
accgtggcgacgctggttgcccaggtgaagcagttgcgcaccgagcttcagaccgcgctg
tccgacaacaggtcgcagcgtgaggagaaccagcgactgcgccagcgcgagaacgccatc
gaccaacgcatcagttccgccctcgaatccgagcgctccaacctgcgccgcgaccaacag
caggcggccagcgcgcgccagcagaccgaggggctgctcgctgacctgcagcagcgcctg
gacagcatcggcgggcgtggcggcggccatgccgatttgccggtggggctgggcctgcgt
gacggcgacgaggccggcatggaaggcggtatgcgctgggtggagccggatgacgcgaaa
caaagcgacgggcgtggcaggtcgaatggcggcataagcttccccaccagcttcggttcc
gcacagagcacgctggaaaccacagcgcaaaccgtggcgaacgcgggcgcacgcgcggca
ggcgtcaagagcccgacgcccgtctataccgtgccgaccaactcgacgctgatggggtcg
gtggcgatgacggcgctgattggccgcgtgccgatcgacggcacggtgaacgatccatac
cccttcaaggtcttggtcgggcctgacaatttgaccgcgaacggcatcgacattcccgat
gtggccggggccgtgttctccggcaccgcatcgggcgactggacgctctcctgcgtgcgc
ggccaggtgcgcagcatcaccttcgtgttccatgacgggaccatccgcaccatccccgag
gatcgtgagggcaaccagcagaacaaccaacaacgcgacggcctgggctggatcagcgac
ccgcacggcattccctgtgtcagcggcgagcggcgcagcaatgcgcagcagtacctcggc
acccaggcgctgatcacggcggctggggctggcgtggcctcgctgatcgaatccgacagt
ggcagggcgtcctatgtcggcgccgacggctccatcggcagcgtgggcatcagcggccag
gaagccgtgggccggattctcgccagcggcgtccaggacatgtcgagctgggtcaacaag
ctctacggccaggccttcgctgccgtttatgtgcagcccggtgccaaggtcgccgtccac
ctcgaaaagccgctcgccatcgacttcgatcccgaaggccgcaaggtcgatcaccgcgca
ggagaaagccatgccctcgaacttgaatag

DBGET integrated database retrieval system