KEGG   Bordetella petrii: Bpet4268
Entry
Bpet4268          CDS       T00637                                 

Definition
(GenBank) putative secreted protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: DUF3438 TPPK_C FAM117
Other DBs
NCBI-ProteinID: CAP44617
UniProt: A9IAQ6
Position
complement(4529522..4530460)
AA seq 312 aa
MKPMKHPVLALLGLLAVAAAVVVSPAVQAVEILRWERMPLAVPLKVGQERIVFIDRNVRV
GVPAGVGERLRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELE
PVRIVEGNNSTARYGDQPDGADAPHARAQEQAGTRTARRETPIPVVLTRFAAQNLYAPLR
TVEALPGVMRVNLRRDLDLGTLMPTLPARAVALASWRLEDQWVTAVRLTNSSNDWISLDP
RVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIHRFDPAVHLPQPKA
AASDDREARHAQ
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaagcccatgaagcatcctgtactcgcgctgctggggctgctggccgtggccgccgca
gtggtcgtgtcccccgctgtccaggcggtggagatcctgcgttgggagcgcatgccgctg
gcggtgccgttgaaggtcggccaggagcgcatcgtgttcatcgaccgaaacgtccgcgtg
ggcgttcccgcaggcgtcggtgagcgcttgcgcgtgcagagcgcgggcggcgcggtgtac
ctgcgcgccagcgagccgatcgagcccactcggctgcaattgcaggacgccgacaccggc
gcgctgatcctgctcgacattgcggcggagccgcccaaggacggcgaagccgagctggaa
ccggtgcgaatcgtcgagggcaacaactcaacagcgcgctatggcgatcagcctgacggt
gccgatgcgccccatgcacgcgctcaggagcaggcgggcacccggacggcgcggcgcgaa
acgccaatccccgtcgtgctgacacgttttgctgcgcagaacctctacgcaccgctgcgc
accgtggaagccttgccaggcgtcatgcgggtcaacctgcgccgcgacctcgacctcggc
acgctgatgccgaccttgccggcacgcgcggtcgcgctcgcctcgtggcgcctggaagac
cagtgggtcactgccgtgcgcctgaccaacagtagcaacgactggatcagcctcgacccg
cgcgtgctgcaaggggatttcctcaccgccaccttccagcacgaggcgcttggcccgcgc
ggaacccccgaggacaccaccgtcctgtacctggtgacgcgcgggcacggcctcgcgcaa
tcgctgctgccggcgatccatcgcttcgaccccgctgtgcatctcccgcagcccaaagca
gcagccagcgacgacagggaggcccgccatgcgcagtaa

DBGET integrated database retrieval system