KEGG   Bordetella petrii: Bpet4270
Entry
Bpet4270          CDS       T00637                                 
Name
(GenBank) conserved hypothetical protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: DUF3487 TraL
Other DBs
NCBI-ProteinID: CAP44619
UniProt: A9IAR3
Position
complement(4531146..4531556)
AA seq 136 aa
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLVVGAPLSWVLRTI
AIAPTFVVLGVALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAAWVGGHVLIS
RSGFWTIRRGMHGGAR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtccgagcaacagcatgtccgtgccgatgggacagtcacgttccttccacaccggctc
aacaggcacccggtggtcgtgcgcggcctcactgccgatgagttgtggatttgctgcggc
ctgtccggcgctgccggcctggtggttggcgcgccgctgtcctgggtgttacgcaccatt
gccatcgcgccgaccttcgttgtcctgggcgtggcgctgggcgttttcatcggcggcggc
atcctgcgccgtctcaagcgtgggcgtcccgacacctggctgtaccggcagttgcagtgg
cgcattgccacgcgccatccgctgatggccgcttgggtgggcggccatgtgctgatctcg
cgctccggcttctggaccatccgcaggggcatgcacgggggcgcgcgatga

DBGET integrated database retrieval system