KEGG   Bordetella petrii: Bpet4275
Entry
Bpet4275          CDS       T00637                                 
Name
(GenBank) hypothetical protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: CAP44624
UniProt: A9IAS7
Position
complement(4533416..4535143)
AA seq 575 aa
MCLSTLCGRCRPWGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFVTQ
DIRRKNAAGEHEVVIVIDPKGDADLLKRMYVEAKRAGRDGEFYIFHLGWPEISARYNAVG
RFGRISEFATRIAGQLSGEGNSAAFREFAWRFVNIIARALVEQGQRPDYMLIQRHVINID
ALFIEYAQHYFAKTEPKAWEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDP
VLDGLRSAVRYDKTYFDKIVASLLPLLEKLTSGKIAQLLAPNYSDLADPRPIFDWMQVIR
KRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYKHGIDDGLPGASAGSRVPINVHA
DEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQVIGNFNNLFMLRV
RETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPSHI
VGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPADLQQLAGHMRQSYSEATQWWEFTSS
PVLQDAALPDDLLDETAIATPTTGTGDTASEEAAP
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtgcctttcaaccctgtgcggccgctgccgcccgtgggggggcctgccgcggcttcac
ggtatcgagccggaggaagtggacgtcagcctgccgctaggggagcgcgtcgggcattca
ctggtgctgggcacgacgcgcgtgggcaagacgcggctcgccgagctgttcgtgacgcag
gacatccgccgcaagaacgccgctggcgaacatgaggtggtcatcgtcatcgaccccaag
ggcgatgccgacctcctgaagcgcatgtacgtcgaggccaagcgcgcgggccgcgacggt
gagttctacatcttccatttgggctggccggaaatcagcgcccgctacaacgcggtgggt
cgcttcggacgcatctcggaattcgccacgcgcatcgcgggacagctctccggcgaaggc
aacagcgcggcgtttcgcgagttcgcttggcgcttcgttaatatcatcgcccgcgcctta
gtggaacaggggcagcgcccggactacatgctgatccagcggcacgtcatcaacatcgac
gcgctgttcatcgagtacgcccagcactacttcgccaagaccgagcccaaggcctgggag
gtgatcgtccagatcgaggccaagctcaacgagaaaaacatcccgcgcaacatgatcggg
cgcgaaaagcgcgtggtggcgctggagcagtacctctcgcaggcgcgcaactacgacccg
gtgctcgacggcctgcgctcggcagtgcgctacgacaagacctacttcgacaagatcgtc
gcatcgctgctgccgctgctggagaagctcaccagcggcaagatcgcccagcttctggcc
ccgaactactccgacctggccgacccacgcccgatcttcgattggatgcaggtcatccga
aagcgcgccgtggtctatgtcggcctcgatgcgctgtccgacgccgaggtcgccgccgca
gtcggcaattccatgttctccgacctggtttcggtcgccggccacatctacaagcacggg
atcgacgacggcctgccgggcgcatcggctggctcgcgcgtgccgatcaacgtccatgcc
gatgagttcaacgagttgatgggcgacgagttcatcccgctgatcaacaagggcggcggc
gctggcctgcaagtcaccgcgtacacacagacgctctcggacatcgaagcacgcattggc
aaccgcgcgaaggccggtcaggtgatcggcaacttcaacaacctgttcatgctgcgcgtg
cgcgagacggctaccgctgaattgctgacccggcaattgccgaaggtcgaggtctatacg
accaccatcgtcagcggcgcgaccgacagctccgatattcgtggagcgacagactttacg
tcaaacacccaagaccgcatcagcatgtccagcgtgccgatgatcgagccatcgcacatc
gtcggcctgcccaaaggccagtgcttcgcgctgctgcagggcggtcagctttggaaggtg
cgtatgccgttgccggcgccagacccggatgaagtgatgccggcggacttgcagcaactg
gccgggcacatgcgccagagctacagcgaggccacgcagtggtgggagttcaccagctcc
ccggtcttgcaggacgcggccttgccggacgatctgctcgatgagacggccatcgccaca
cccaccaccggcacgggcgacacggccagcgaagaggccgcgccatga

DBGET integrated database retrieval system