KEGG   Bordetella petrii: Bpet4278
Entry
Bpet4278          CDS       T00637                                 

Definition
(GenBank) conserved exported protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_3
Other DBs
NCBI-ProteinID: CAP44627
UniProt: A9IAT6
Position
complement(4536150..4536755)
AA seq 201 aa
MAAPAIAATSVSQCLRALVIAAGLCACAAHAQELPPPAYQLAAQRAGIPSTVLYAVALQE
SGIRRNGRIVPWPWSLNVAGQSRRFTTRADACAGLQQAMRATPHTRIDAGLGQINLGYHQ
QRYASPCDLLDPYSNLAIAAEILKEQHTSGEDWLPAIGRYHRPAGGEPAARYRRSVSRHL
ARVQGTHPTAAAIAVHQESTP
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcagcgccagccatagcggccacctccgtttcgcagtgcttgcgcgcactggtgatc
gcggcgggcctgtgcgcctgcgccgcccatgcccaggagcttccgccaccggcttaccag
cttgccgcacagcgcgcgggcatcccctcgacggtgctctacgccgtggctttgcaggaa
agcggcatccgccgcaacgggcgcatcgtcccgtggccgtggtccctcaacgtcgccggt
cagtcgcgccgcttcaccacccgtgccgacgcctgcgctggtttgcagcaggcaatgcgc
gccacgccgcacacacgcatcgacgcgggcctgggccagatcaacctcggctaccaccag
cagcgctacgccagcccgtgcgacctgctcgacccatacagcaacctcgccatcgccgct
gaaatcctgaaagagcagcacacctcgggcgaggactggttgccggcgatcggtcgctac
caccgtcctgcgggcggagaacctgcggctcgttaccggcgcagcgtgtcgcgccacctt
gcccgtgtgcagggcacacacccaaccgccgcggccatcgccgtgcaccaggagagcacc
ccatga

DBGET integrated database retrieval system