KEGG   Bordetella petrii: Bpet4702Help
Entry
Bpet4702          CDS       T00637                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpt  Bordetella petrii
Pathway
bpt00010  Glycolysis / Gluconeogenesis
bpt00053  Ascorbate and aldarate metabolism
bpt00071  Fatty acid degradation
bpt00280  Valine, leucine and isoleucine degradation
bpt00310  Lysine degradation
bpt00330  Arginine and proline metabolism
bpt00340  Histidine metabolism
bpt00380  Tryptophan metabolism
bpt00410  beta-Alanine metabolism
bpt00561  Glycerolipid metabolism
bpt00620  Pyruvate metabolism
bpt00625  Chloroalkane and chloroalkene degradation
bpt00903  Limonene and pinene degradation
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet4702
   00053 Ascorbate and aldarate metabolism
    Bpet4702
   00620 Pyruvate metabolism
    Bpet4702
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bpet4702
   00561 Glycerolipid metabolism
    Bpet4702
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet4702
   00310 Lysine degradation
    Bpet4702
   00330 Arginine and proline metabolism
    Bpet4702
   00340 Histidine metabolism
    Bpet4702
   00380 Tryptophan metabolism
    Bpet4702
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpet4702
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bpet4702
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bpet4702
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bpet4702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAP45054
UniProt: A9IFK4
Position
4960948..4962426
Genome map
AA seq 492 aa AA seqDB search
MKRYQLYIDGQYVDPASGEWFESDNPCDGKPWASIPKSNAEDVDRAVQAAHRAGREGPWA
TYTPSQRGQLLHRLGDLIARDAEALARTEVRDNGKLYAEMAGQLKYMPQWFYYYGGLADK
IEGTVPPIDKPGHFGYTRREPLGVVAAITPWNSPLLLTAWKIAPALAAGCTLVLKPSEFT
SASTLEFVKLFEEAGFPPGVVNAVTGFGAEVGTPLVTHPLVRKITFTGSDATGRLINEQA
SRDFKHVSLELGGKSPNIVFDDANLDDAVNGAVSGIFAATGQTCIAGSRLLLQDSIYDAF
VEKLLALARTAKMGDPMQADTQVGPITTPPQYRKVLEYIDIARNEGARLLLGGAPMREGP
WKDGRFIQPTIFGDVDNAMRIAQEEVFGPVLSIIRFKDEDEAVRLGNDVRFGLGAGVWTR
DIGRALRMADRIQSGTVWVNTYRLVSYLMPFGGYKDSGLGRESGIDAMREYQQVKSVVIN
AGAPVGNPFVMR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgctaccagctctacatcgacggccaatacgtcgacccggcctcgggcgagtgg
ttcgagtccgataatccctgcgacggcaagccgtgggccagcatccccaagagcaacgcc
gaagacgtagaccgcgccgtgcaggcagcccaccgcgccggccgcgaaggtccgtgggcc
acgtatacgcccagccagcgcgggcaattgctgcaccgcctgggcgacctgatcgcccgc
gatgccgaagcgctggcccgcaccgaagtgcgcgacaacggcaagctgtacgcggaaatg
gcgggccagctcaagtacatgccgcaatggttctattactacggcggcctggccgacaag
atcgaaggcaccgttccgcccatcgacaagcccggccacttcggctacacgcgccgcgag
ccgctgggcgtggtggccgccattaccccctggaattcgccgctgctgctcactgcctgg
aaaatcgcgccggcgctggccgccggctgcacgctggtgctcaagccgtccgaattcacc
tcggcctctaccctggaattcgtcaagctgtttgaagaggccggcttcccgccgggtgtg
gtcaatgccgttaccggtttcggcgccgaggtcggcacgccgctggtcacgcacccactg
gtgcgcaaaatcacgtttaccggctccgacgccaccggccggctcatcaacgaacaggcc
tcgcgcgatttcaagcacgtcagcctggaactgggcggcaagtcgcccaacatcgtgttc
gatgacgccaacctggacgacgccgtcaacggcgcggtgtccggcatttttgccgccacc
ggccaaacctgcatcgccgggtcgcgcctgctgctgcaagacagcatctatgacgccttc
gtcgaaaaattgctggcgctggcgcgcaccgccaagatgggcgacccgatgcaggccgac
acgcaggtgggccccattaccacgccgccgcagtaccgcaaggtgctcgaatacatcgac
atcgcccgcaacgaaggcgcgcgcctgctgctgggcggcgcccccatgcgcgagggtccc
tggaaagacggccgcttcatccagccgaccatcttcggcgacgtcgacaacgccatgcgc
atcgcccaggaagaagtcttcgggccagtgctgtccatcatccgcttcaaagacgaagac
gaagccgtcaggctgggcaacgacgtgcgcttcggcctgggcgcgggtgtctggacgcgc
gacatcggccgcgcgctgcgcatggccgaccgcatccagtcgggcacggtgtgggtcaac
acgtatcgcctggtcagttacctgatgccgttcggcggctacaaagattcgggcctgggc
cgcgaaagcggcatcgacgccatgcgcgaataccagcaggtgaaaagcgtggtcatcaat
gccggcgcaccggtgggcaatccgttcgtgatgcgatag

DBGET integrated database retrieval system