KEGG   Bacillus pumilus SAFR-032: BPUM_0003Help
Entry
BPUM_0003         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4_2 AARP2CN
Motif
Other DBs
NCBI-ProteinID: ABV60703
UniProt: A8F8Y6
Position
2825..3040
Genome map
AA seq 71 aa AA seqDB search
MPNPITIEKEMITLGQFLKLAEVIQSGGMAKWFLSEHEVFINQEPDNRRGRKLYPGDVVE
IEGYGTFQVVN
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaccctataaccattgagaaagaaatgattacattagggcaatttttgaaatta
gccgaagtcatccaatctggcggaatggcgaaatggtttttgagtgaacatgaggtgttc
attaatcaagagccagataatagacggggacgcaaactatacccaggagatgttgtcgag
atagaaggttatggcacatttcaagttgtgaattag

DBGET integrated database retrieval system