KEGG   Bacillus pumilus SAFR-032: BPUM_0022Help
Entry
BPUM_0022         CDS       T00599                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00450  Selenocompound metabolism
bpu00970  Aminoacyl-tRNA biosynthesis
bpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BPUM_0022
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BPUM_0022
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpu01007]
    BPUM_0022
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpu03016]
    BPUM_0022
Enzymes [BR:bpu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BPUM_0022
Amino acid related enzymes [BR:bpu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BPUM_0022
Transfer RNA biogenesis [BR:bpu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BPUM_0022
 Prokaryotic type
   Other AARSs
    BPUM_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABV60722
UniProt: A8F905
Position
47971..49971
Genome map
AA seq 666 aa AA seqDB search
MPEKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYDVMYLTGTDEHGQKIQ
QKAEEQNITPIEYLDPVVADIQSLWKKLDISNDDFIRTTEKRHTIIIGQVFQKLLDQGDI
YLDQYEGWYSIPDETFYTETQLVDVEHNEKGEVTGGKSPDSGHPVELIKEESYFFRMSKY
ADRLLDYYEKNPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPNNPKHVIYVW
IDALFNYLTAIGYGTDQDEKYKKYWPANVHLVGKEIVRFHTIYWPIMLMALDLPLPKQIF
AHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFVERVN
YDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEELKAVAEQTVKAYEEAMENLEF
SVALSNVWTLISRTNKYIDQTAPWVLAKDESKRKELHSVMYHLAESLRITAVLLTPFLTK
TPEKIFFQLGIEEEKLKSWDSILSFGAIQQATVQKGEPLFPRLEVEEEVAYIKEKMQGSA
PKVEEEKIEIEETELPELGEEIAFDDFSKVDLRVAQVLEAAPVKKADRLLKLQLDFGFEK
RQIVSGIAKHYQPEELVGKKLVCVANLTPVKLRGEISQGMILTGETGGKLKVLEVDQSLA
NGTKIL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaagaaaaaaacgttctatctgacaacacctatttactatccgagcggaaaa
ttacatattggacatgcttatacgacagtagcaggggatgctatggctcgttataaacgt
cttcaaggctatgatgtgatgtatttaacgggtacagatgagcacggacaaaaaattcag
caaaaagctgaagaacaaaacatcacaccgatcgagtatttagatccggtcgtagcagac
attcaatcactatggaagaaactcgacatttccaatgatgatttcatccgtacaacagaa
aaaagacatacgataatcattgggcaagtgtttcaaaagctacttgatcaaggtgatatt
tatttagatcaatatgaaggctggtacagtattccagatgagacattctatacggaaaca
cagcttgtggatgtggagcacaatgaaaaaggagaagtcactggtgggaaaagccctgac
agcggacatcctgtcgaattaattaaagaggaatcatatttcttccgtatgagtaagtat
gcagatcgtttactagactattacgaaaagaatccaacgttcattcagcctgaatcaaga
aagaatgaaatgattaataacttcatcaaaccaggtttagaggatttggctgtatcaaga
acaacctttgattggggaattaaagttccaaacaatccaaagcacgttatctacgtatgg
attgatgcgttgttcaactatttaactgcgattggttacggaacagatcaggatgaaaaa
tataaaaaatattggcctgctaacgtgcatctcgtagggaaagaaattgtgcgtttccat
acgatttattggccaattatgctgatggcactcgatctgccgctgccaaaacaaatattc
gcacacggatggctactgatgaaagatggcaagatgtctaaatcaaaagggaacgtagtc
gatccggtcacattaatagatcgctacggtcttgatgcccttcgttattatctccttcgt
gaagtaccttttggtgcggatggtgtgtttacaccagaaggattcgtggaacgtgtaaac
tatgaccttgccaatgatttaggtaacttgcttaaccgtacagtggcaatggttcaaaaa
tattttgacggtacattaagtagctataagggtccagttaatgagtttgatgaggagctt
aaagcagtagcagagcaaacagtcaaagcctatgaagaagcgatggaaaaccttgaattc
tcggtggctctttcaaatgtttggacattaatcagcagaacgaataaatatattgatcag
acagctccttgggtgctggcaaaggacgaatcaaaacgaaaagagctgcattctgtcatg
tatcatttagcagaatcattgcgcatcacagcagtgctcttaacgcctttcctaacgaaa
acacctgagaaaatcttcttccagcttggcattgaagaagaaaagcttaaaagctgggat
agcattctatctttcggtgcgattcaacaagcgacggtacaaaagggagagcctttgttc
ccgcgtttagaggttgaagaagaagtagcatatattaaagagaaaatgcagggaagtgca
ccaaaggtagaagaagagaaaatagaaatagaagaaacagaattacctgagctgggagaa
gaaattgcttttgatgatttctcaaaagttgatcttcgagtcgcacaggtgctggaagca
gccccagtgaaaaaagcagatcgtctcttaaagctgcagcttgattttggatttgaaaag
agacaaattgtttcagggatagccaagcattatcaacctgaggagttagtagggaagaag
ctcgtctgtgtagcgaatctcacaccagttaaactcagaggggaaatttcccagggaatg
attttaactggagagactggtgggaaattgaaagttcttgaagtggatcaatctctagca
aatggaacaaaaattttataa

DBGET integrated database retrieval system