KEGG   Bacillus pumilus SAFR-032: BPUM_0032Help
Entry
BPUM_0032         CDS       T00599                                 

Definition
(GenBank) reactive intermediate/imine deaminase
  KO
K09022  2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BPUM_0032
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase
     BPUM_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: ABV60732
UniProt: A8F915
Position
57637..58014
Genome map
AA seq 125 aa AA seqDB search
MTKVVQTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTAAGDFVNGDIKEQTHQVFRNLNAV
LEAAGASFETVVKATVFIKDMEQFGEVNEVYGEYFHTHKPARSCVEVARLPKDALVEIEV
IALVK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagttgttcaaaccaaacatgcaccagcagccattggaccttactctcaaggg
attatagtcaataacatgttttacagctccgggcagattccattaacggcagctggagac
tttgtaaatggagatattaaagaacaaactcatcaagtgttccgtaatcttaatgccgta
cttgaagcggcaggtgcttcctttgagacagtcgtgaaagcgacagtttttatcaaagat
atggaacaattcggagaagtaaatgaagtgtacggtgagtatttccatacacataagcca
gctcgttcttgtgtggaagtagcaagacttcctaaggatgcactcgtagaaattgaagtg
attgcattagtcaagtaa

DBGET integrated database retrieval system