KEGG   Bacillus pumilus SAFR-032: BPUM_0040Help
Entry
BPUM_0040         CDS       T00599                                 

Definition
(GenBank) stage VI sporulation protein D
  KO
K04769  AbrB family transcriptional regulator, stage V sporulation protein T
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpu03000]
    BPUM_0040
Transcription factors [BR:bpu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BPUM_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoVT_C MazE_antitoxin PrlF_antitoxin GAF_3
Motif
Other DBs
NCBI-ProteinID: ABV60740
UniProt: A8F923
Position
66579..67115
Genome map
AA seq 178 aa AA seqDB search
MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAK
EYADALFDSLGHSILICDRDTYIAVSGSSKKEYLNKSISDLLERTMDQRNSVLEESKKEI
QLVDGIDDDVSAYTIAPIVANGDPIGAVVLFSKERSMGEVEHKAAETAAGFLARQMEH
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaactggaattgtacgccgcatcgatgatctaggtagagtggttattccgaag
gagattcgcagaacattgcgcatccgggaaggagatccgcttgagattttcgtcgaccgc
gatggagaagtaattttgaagaagtattcgccgattagtgagctaggagactttgcaaag
gaatatgctgatgcattattcgacagtttgggtcattccatcctgatttgtgatcgagat
acgtatattgctgtatccggcagttcgaaaaaagagtacttaaacaaatccatcagtgat
ttacttgaacgaacaatggaccagcgtaattctgttttagaagaaagcaaaaaagaaatt
caacttgtcgatggtattgatgatgacgtatctgcttataccattgcacctattgttgca
aacggagatccgattggcgccgtcgtcttattttctaaagagcgttcaatgggggaagtg
gagcataaagcggcagaaacggcagctggcttcttagcccgtcaaatggaacactag

DBGET integrated database retrieval system