KEGG   Bacillus pumilus SAFR-032: BPUM_0048Help
Entry
BPUM_0048         CDS       T00599                                 

Definition
(GenBank) stage II sporulation protein E
  KO
K06382  stage II sporulation protein E [EC:3.1.3.16]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BPUM_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE YfhO
Motif
Other DBs
NCBI-ProteinID: ABV60748
UniProt: A8F931
Position
73091..75574
Genome map
AA seq 827 aa AA seqDB search
MEKLERRTDLTGAGFERISAGLKKMKNLFLHHTHSLFFYKGFIYVVLGFLLGRAFILSEI
MPFALPFFGSMLLIKRDKSMLACLALLAGAMTISPQNALFVFASLIVFLLMSKVVSFIIK
DPVKTLPVVIVLSMLITRGAFVYLEQGAVQSYDYVMAGVEAGLAFILTLIFLQSLPIFTV
RKIKHSLKVEEIICFMILIASVLTGLAGITFQGMQAEHILSRYVVLSFAFIGGASIGCTV
GVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAGAAIGLIVGSLLISLYGEGSAG
LMNTLYESLIAVVLFLLTPQSVTSKVAKYIPGTVEHVQEQQQYARKVRDVTAKKVDQFSN
VFHALSESFATFYESIPEEKKQEEDVDLFLSTITERSCQTCYKKNKCWVQNFDTTYELMK
QVMQESDEKTYEHNRKLKKKFSQHCSKSKHVEELIEEEIAYYKANQTLKKKVQDSRRLVA
EQLMGVSQVMEDFSREIKREREQHFIQEEQMIEALQHFGIEIQQVEIYSLEQGNVDIEMR
IPYCQGHGECEKIIAPMLSDILEEQILVKAEQCAEHPTGYCHVVFGSAKSYRVATGVAHA
AKGGGLVSGDSYSMMELGAGKYAAAISDGMGNGARAHFESNETIKLLEKILASGINEKVA
IKTINSILSLRTTDEIYSTLDLSIIDLQDASCKFLKIGSTPSFIKRGDQVMKVQASNLPI
GIIDEFEVEVVSEQMKAGDLLIMMSDGIFEGPKHIENHDLWVKRKMKSFKTEDPQEIADL
LMEEVIRTRSGQIDDDMTVVVIRLDHNTPKWASIPTGTFYLEKQEIS
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactagaaagaagaactgatttaacaggagcggggtttgaaagaatcagtgca
gggttaaagaagatgaaaaacctgtttcttcatcatacgcattctctttttttctataaa
gggtttatttatgtcgttctaggctttttattaggacgagcctttatattatctgaaatc
atgccgtttgctctgcctttctttgggtccatgctgcttatcaaaagagataagtccatg
cttgcttgtctcgctttacttgctggagccatgacgatatcacctcaaaatgcattgttt
gtgtttgcatcgctgatcgtcttccttctgatgtccaaggtggtttctttcatcatcaaa
gatccagtgaaaacattgccggttgtcattgtactgtcaatgctgatcaccagaggagca
tttgtttacctagagcaaggtgctgtgcaaagctacgattacgttatggcgggtgtcgag
gcaggacttgccttcattttgacactgattttccttcaaagcctgccgatttttacagtt
aggaaaatcaaacactccttaaaggttgaagaaattatttgttttatgattttaattgcc
tcagttttaacaggtctggctgggatcacatttcaaggaatgcaggcagaacatattttg
tcacgatatgtagtattgagctttgcctttattggaggagcgagtattggttgtacagtt
ggtgtcgtgactggattaattctcggtctcgctaacatcggaaacctttatcaaatgagt
cttcttgccttttcaggtttattagggggattgctgaaagaggggaagaaagcaggcgca
gccattggcttaattgtgggctccttactgatttcattgtacggagaaggatcagcagga
ctcatgaacacgctatatgaatcgctgattgcggttgtgctcttcttgctcacgccacaa
tccgtaacctctaaggtagcgaaatatattcctggtacggtagagcatgtacaggagcag
cagcaatacgcccggaaagtacgagatgtgacagcaaaaaaggtagaccaattttctaat
gtatttcatgcgctgtctgagagttttgcgacattttacgaatccattcctgaagaaaag
aaacaggaagaggatgtagatctttttttaagtacgatcacagaacgatcctgtcaaacg
tgctataagaaaaataaatgctgggtgcagaactttgatacaacctatgaactcatgaaa
caagttatgcaagaatctgatgaaaaaacctacgagcataaccggaaattgaagaagaaa
tttagccagcactgctcaaaatcaaaacatgttgaggaattgattgaagaggagatcgct
tactataaagccaaccagaccttgaagaaaaaggtccaagacagcagacgacttgtagct
gaacagctgatgggcgtctcacaagtgatggaggatttttcccgggaaataaaacgggaa
agagaacagcattttattcaagaagagcagatgatagaagcacttcagcactttggaatt
gaaattcaacaagtagaaatttatagcttggagcaggggaatgtcgatattgaaatgaga
atcccctattgccaaggacatggggaatgtgagaaaatcatcgcccctatgctctcagat
attttagaagagcagattttagtcaaggcagagcagtgtgcagagcacccaacaggctat
tgtcacgttgtatttggctctgcaaagtcatatcgagtagctacaggcgtagcgcatgca
gcgaaaggcggagggttagtgtctggagacagctacagcatgatggagctgggtgcgggc
aaatatgctgcagctattagtgatgggatgggtaatggagcaagggctcactttgaaagc
aatgaaacgattaagctgttagaaaaaatattagcttcaggtatcaatgaaaaagtagcg
attaaaaccattaatagtattttatctttacgaacgacagatgaaatctattcaacatta
gatttatccattattgatttacaggatgcgagctgtaagttccttaagatcggttcaaca
cccagctttattaaacggggtgatcaggtgatgaaggtacaagcgagcaatttaccgatt
gggattattgatgaatttgaagtggaggttgtgagtgaacagatgaaggcaggagatctg
ctgattatgatgagcgatggcatctttgaaggaccaaagcatattgaaaatcatgatctc
tgggtgaagcgcaaaatgaaaagctttaaaacagaagatccgcaagagattgctgattta
ttaatggaagaggtcattcgaacaagatcgggtcaaatcgatgacgatatgacggttgtt
gtcatcaggcttgatcacaatacgcctaaatgggcatccattccgacaggtacattctat
cttgagaaacaagagatttcttga

DBGET integrated database retrieval system