KEGG   Bacillus pumilus SAFR-032: BPUM_0050Help
Entry
BPUM_0050         CDS       T00599                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpu01001]
    BPUM_0050
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BPUM_0050
Protein kinases [BR:bpu01001]
 Serine/threonine kinases: Other
  Bacterial family
   BPUM_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase APH Pkinase_Tyr WaaY TRIQK
Motif
Other DBs
NCBI-ProteinID: ABV60750
UniProt: A8F933
Position
76366..77376
Genome map
AA seq 336 aa AA seqDB search
MMNSVSNIPLGTVIQGKWHHHHYRIVKELGKGANGIVYLAESPNGQVALKVSDDSMLIAS
EVNVLKSFSKAPVKTMGPSFYDMDDAIYPGMLQKRSFYVMEYVRGPLLLDFVKQKGDEWI
VVLMVQLLSNLAHLHQEGWIFGDLKPDNLIVSGPPATIRCIDVGGTTKAGRAIKEYTEFF
DRGYWGFGTRKAEPSYDLFALSMVMVNCAYKKEFKKGVEPEKQLYRAIEGHPLLKRYERV
LKAALQGKYQSAAAMKSAMLKEGQLIASRKASQKKQQQKNGQRPAGQQNQQVTSRSRVAA
AKRTQVRKKSGGLFETILIVCSVLALYCAYVVLFLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcggtttctaacattccgttaggcacggtgattcaagggaaatggcatcac
catcattaccgcattgtaaaagagctgggaaaaggggcgaacggtattgtctatctagcc
gaatcgccaaatggtcaagtagcccttaaagtgagtgatgacagtatgctcattgcatct
gaagtcaatgtattaaaatccttttctaaggctcctgtgaaaaccatggggccttctttt
tatgatatggatgatgcgatttatcccggcatgcttcaaaagcgttccttttatgtgatg
gagtatgtcagaggcccattactgcttgattttgtcaaacaaaaaggtgatgagtggatc
gtcgttttaatggttcagcttttatctaacctagctcatttacatcaagaagggtggatc
tttggtgacttgaagccagacaatcttatcgtgtcaggtcccccagccacgatccggtgc
attgatgtagggggaacgacaaaagcaggcagagcaatcaaggaatatacagagtttttt
gatcgaggctattggggattcggtacaagaaaggcagagccatcctatgatctatttgcc
ttaagcatggtgatggtgaattgtgcgtataagaaagaattcaaaaaaggagtagaaccg
gaaaagcagctttacagagccattgaaggacatcctttattaaagcgatatgaaagggta
ttaaaggctgctctacaaggtaaatatcaatcagcggcggcaatgaagagtgcgatgctg
aaagaaggccagctgatcgcttcaagaaaagcgagtcaaaagaagcaacagcaaaaaaat
ggacaaaggccagctggtcaacaaaaccaacaggtgacttcacgatcgagagttgcagca
gcaaaaagaacacaagtacgcaaaaaatcaggtgggctttttgaaacgattctaatcgtg
tgcagtgtacttgctctttactgtgcatatgtcgttttgttcctgctatag

DBGET integrated database retrieval system