KEGG   Bacillus pumilus SAFR-032: BPUM_0053Help
Entry
BPUM_0053         CDS       T00599                                 

Definition
(GenBank) cell division protein FtsH
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpu01002]
    BPUM_0053
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bpu03110]
    BPUM_0053
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BPUM_0053
Peptidases [BR:bpu01002]
 Metallo Peptidases
  Family M41: FtsH endopeptidase family
   BPUM_0053
Chaperones and folding catalysts [BR:bpu03110]
 Other chaperones and cochaperones
  AAA proteases
   BPUM_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M41 AAA FtsH_ext AAA_22 AAA_5 TIP49 AAA_16 RuvB_N IstB_IS21 Mg_chelatase AAA_33
Motif
Other DBs
NCBI-ProteinID: ABV60753
UniProt: A8F936
Position
79527..81431
Genome map
AA seq 634 aa AA seqDB search
MNRVFRNTIFYILILLLVIGVVSWLGSPNQKPENMSYSKFSQNLSAGKVESISIQPVRGV
YEIRGQLDGAKKDEYFITHVPDGQGVDQIYSALKNTDVKVEPAPETNGWLQVLTTIIPFI
IIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDVAGADEEKQELVEVVEFL
KDPRKFAELGARIPKGVLLVGPPGTGKTLLARASAGEAGVPFFSISGSDFVEMFVGVGAS
RVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFSANEGI
IIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREEVLKVHAKNKPLDDTVNLKAIAS
RTPGFSGADLENLLNEAALVAARHNKKKIDMRDIDEATDRVIAGPAKKSRVISKKERNIV
AYHEAGHTVIGLILDEADMVHKVTIVPRGQAGGYAVMLPREDRYFQTKPELLDKIVGLLG
GRVAEEITFGEVSTGAHNDFQRATGIARRMVTEFGMSDKLGPLQFGQAQGGQVFLGRDFN
NEPNYSEAIAYEIDQEVQRFIKESYERAKQILTENKDKLEIIAQALLEVETLDAEQIKSL
YETGKLPERVYADDEEKNDDVKVNIKKKEEDEEI
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgggtttttcgtaatacgattttttatatacttattttattacttgtgataggg
gtagtcagttggttaggatcccctaatcaaaagcctgagaacatgtcttacagcaaattt
tcgcaaaatctaagtgcgggaaaagtggagagtatctccattcagcctgtaagaggggtt
tatgaaattcgtggtcaattagatggcgcgaagaaagatgaatacttcattacccatgtt
ccagatggtcaaggtgttgaccagatttacagtgcactgaagaatacagatgtaaaagta
gaaccagcacctgaaacaaatggatggctgcaagttctgacaaccatcattccgttcatc
atcatctttatcctgttcttcttcttattgaaccaagctcagggcggtggaagccgtgtc
atgaactttggtaagagtaaggcgaagctttacacagaagagaagaaacgtgtgaaattt
aaagatgttgccggtgcagatgaagaaaagcaagaacttgtagaagtggttgaattcctg
aaggatccacgtaaattcgcggagcttggcgcaagaattcctaaaggggttttactagta
ggacctccaggtacaggtaaaacattgcttgcgagagcatctgctggagaagcaggcgtt
cctttctttagcatcagtggttctgacttcgtcgagatgttcgtcggtgtcggtgcatca
cgtgtacgtgatttattcgaaaatgcgaaaaagaatgcaccatgcttaatctttattgat
gagattgatgcagtgggtcgtcagcgtggagcaggtcttggcggtggtcatgacgagcgt
gaacaaacgcttaaccagcttcttgttgaaatggatggttttagtgcgaacgaaggtatt
attatcatcgctgcgacaaaccgtgcagatatcctagatcctgcattgctgcgtccggga
cgttttgaccgtcaaattacggttgaccgcccagatgtcattggccgtgaagaagtactg
aaggttcatgcgaaaaacaaaccgcttgatgacacagtgaacttgaaagccattgcaagc
agaacacctgggttctctggagcagatcttgagaacttactaaacgaagcagcacttgtt
gctgcccgtcataacaaaaagaaaattgatatgcgtgatatcgacgaagcgactgaccgt
gttatcgctggaccggcgaagaaaagccgtgtcatttcgaagaaagaacgtaatatcgtg
gcgtaccatgaagcaggtcatactgtcattggtcttatcctagacgaagcggacatggtg
cataaagtaacgatcgttcctcgtggtcaggcaggcggatatgcggtcatgcttccaaga
gaagaccgttatttccaaacgaagcctgagcttcttgataaaattgtcggcttgctcggc
ggtcgtgttgcagaggaaattacgtttggcgaagtaagtacaggcgctcataacgacttc
cagcgtgcaactggcattgcaagaagaatggtcacagagttcggtatgtctgataaactt
ggtccactacaattcggtcaagcacaaggaggtcaagtattccttggccgtgatttcaac
aacgagccgaattatagtgaagcgatcgcttacgaaattgaccaagaagttcagcgtttc
atcaaggaaagctacgaacgtgcgaaacaaattctcactgagaataaagataagttagaa
attatcgcacaagctcttctagaagttgaaacattagatgctgagcaaattaaatctctt
tacgaaactggaaagcttccagagcgtgtatacgcagatgacgaagagaaaaatgatgat
gtgaaagtaaacatcaagaaaaaagaagaagacgaggagatctaa

DBGET integrated database retrieval system