KEGG   Bacillus pumilus SAFR-032: BPUM_0062Help
Entry
BPUM_0062         CDS       T00599                                 

Definition
(GenBank) dihydroneopterin aldolase
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00790  Folate biosynthesis
bpu01100  Metabolic pathways
Module
bpu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPUM_0062
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     BPUM_0062
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     BPUM_0062
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     BPUM_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FolB
Motif
Other DBs
NCBI-ProteinID: ABV60762
UniProt: A8F945
Position
89098..89436
Genome map
AA seq 112 aa AA seqDB search
MEFYGYHGVFAEENKLGQRFRVDLTASLDLSKAGQTDDLNETINYAELYQICKSIVEGES
VNLVETLTERIASQVLKDFLTVQECTVKVIKPDPPIPGHYQSVAIEMTRSRA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaattttacggctaccatggcgtatttgcagaagaaaataaattaggacagcggttc
cgcgtggatttaacagcttcacttgatttaagtaaagccggacaaactgatgacctcaat
gagaccatcaattatgcggagctctaccaaatctgcaaaagcattgtagagggtgaatca
gtcaacctcgttgaaacactaacagaaagaattgcaagccaagtgttaaaggactttctg
acagttcaggaatgcactgtgaaggtgattaaaccagatccgccaattccaggacactat
cagtccgttgccattgaaatgacgagatcgcgcgcatga

DBGET integrated database retrieval system