KEGG   Bacillus pumilus SAFR-032: BPUM_0072Help
Entry
BPUM_0072         CDS       T00599                                 

Definition
(GenBank) DNA repair protein RadA
  KO
K04485  DNA repair protein RadA/Sms
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpu03400]
    BPUM_0072
DNA repair and recombination proteins [BR:bpu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BPUM_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPase AAA_25 ChlI DnaB_C Rad51 Lon_C AAA_16 AAA_22 AAA_24 AAA_5 DUF2075 AAA_30 AAA_14 AAA RecA NTPase_1 ATPase_2 ABC_tran KTI12 GvpD AAA_19 Zeta_toxin NACHT Isochorismatase KdpD DAP3 T2SSE IstB_IS21 ArsA_ATPase HypA
Motif
Other DBs
NCBI-ProteinID: ABV60772
UniProt: A8F955
Position
104253..105632
Genome map
AA seq 459 aa AA seqDB search
MAKTKSKFICQSCGYESAKWMGKCPGCGTWNSMTEEVVRKEPANRRSAFNHSVQTIQKPS
PISAIETSDEPRIKTNLEEFNRVLGSGIVKGSLVLIGGDPGIGKSTLLLQVSAQLSDKNQ
NVLYISGEESIKQTKLRADRLGIKSTSLHVLAETDMEYITSAIQEMKPAFVVVDSIQTVY
QSDITSAPGSVSQVRECTAQLMKIAKTNGIPIFIVGHVTKEGSIAGPRLLEHMVDTVLYF
EGERHHTFRILRAVKNRFGSTNELGIFEMREEGLTEVLNPSEIFLEERSAGVSGSCVVAS
MEGTRPVLVEIQALISPTSFGNPRRMATGLDHNRVSLLMAVLEKRVGLLLQNQDAYLKVA
GGVKLDEPAIDLAIAVSIASSFKDAAPHQADCFIGEVGLTGEVRRVSRIEQRVQEAAKLG
FKRMFIPQANIDGWKKPRGIELVGVENVAEALRISLGGS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacgaaatcaaaatttatatgccaatcgtgcggttatgagtcagccaaatgg
atggggaaatgtccaggctgcggcacgtggaacagtatgacagaagaggtcgttcgtaaa
gagccagcaaaccgtcgaagcgcttttaaccattctgttcaaaccattcaaaaaccttca
cctatatctgcaattgaaacatcagatgaaccccgaatcaaaacgaatttagaagaattt
aatcgagtattaggaagtggaattgtcaaaggctctcttgttctcattggcggagatcct
gggattgggaagtccactttattattacaagtatcagcacagctctcagataaaaatcag
aatgtattatacatatctggtgaggagtccattaaacaaacgaagctaagagcggaccgc
ctcggcataaaaagcacctctttacatgttttggctgaaaccgatatggagtatataacg
tctgctatacaagagatgaaacccgcttttgtcgtggtggattcgattcaaaccgtttat
caaagcgatattacgtcagctcctgggtctgtatctcaagtgagagaatgtacagcacag
ctgatgaagattgcaaagacaaatgggattccaatttttatcgttggtcacgtgaccaaa
gaaggctcgatcgcaggcccacgtcttttagagcatatggtggacacggttctttatttt
gaaggcgagcgtcatcatacgtttcgtatcttacgtgcggtgaaaaaccgatttggctcg
acgaatgaactagggatttttgaaatgagagaggaagggctcacggaagtattaaaccca
tccgaaattttcttagaagaacgttcggcaggtgtatcgggttcgtgtgtcgttgcctca
atggaaggaacaagacctgttctagtcgagatacaagcattaatttcaccgacaagcttc
ggaaatccgcgtagaatggccactggtcttgatcataatcgagtgtcactactcatggcg
gttttagaaaaacgtgttggactgcttctgcaaaaccaggatgcgtatttaaaggtcgca
ggcggtgtgaagcttgacgaaccagcaattgacttggccattgcggtcagcattgcatca
agctttaaagacgcagcgccgcatcaagcggattgctttataggagaggtcggcctgacg
ggagaagtcagaagagtatcaagaattgaacagcgtgtgcaggaagctgcgaaactagga
tttaaacgaatgtttattcctcaggcaaatatagatggatggaaaaagccgagagggatt
gagttagtcggtgtagaaaatgtagcggaggcacttcgaatttcactagggggatcatag

DBGET integrated database retrieval system