KEGG   Bacillus pumilus SAFR-032: BPUM_0503Help
Entry
BPUM_0503         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YaaC DUF4629
Motif
Other DBs
NCBI-ProteinID: ABV61198
UniProt: A8FAD1
Position
complement(14597..15565)
Genome map
AA seq 322 aa AA seqDB search
MKSSGWKDLKRFYSLETSQKFLYQQYEKRSIQDANQQAYKNCERFIYFLKHGHTFYEQAA
IAPLELKPILLFYGMAQLLKACLLTVDPYYPSQTSVLAHGVTSRKRKKQHYRFSKDEVKI
QRNGLCMHVLKHLFHLNGLEDERFTMIHLLSKIPEMSHILEFQKQPSTLVKVEKDNGMMI
QDHIPLLYNMSAERFIEYFEFHTSWKLKQREAKKLAFDVSLEENPAFATHLHYDLEANQW
YIPSTRDSFLGIPEIISHYLLMYNLSMIARYETEWWYELLSQYISDDYVMIERYMEIAEE
KFPAYIMMLLEEKTKKTSSKWN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttcaggatggaaggatttaaaacgtttttactcactcgaaacttcccaaaag
tttctatatcaacaatatgagaaacggagcattcaagatgcaaaccagcaagcctataaa
aactgtgaacggtttatttattttttaaagcatggtcatacattctatgaacaggcagct
atcgctccactcgaactgaagcccattttattattttatggaatggctcagttgctaaag
gcatgtttactgacagttgatccttactatccttctcaaacttctgttttggcacacggt
gtaacatcgagaaagagaaagaagcagcactaccgttttagtaaagatgaagtgaaaatt
cagcgaaatggactatgcatgcatgtgttaaagcatctatttcatttaaatggacttgaa
gatgagcgatttacgatgattcacctcctttcaaagatacctgagatgagtcatattctg
gagtttcaaaagcagccctcgacattagttaaagtagaaaaagacaatggcatgatgatt
caagatcatattccattgctttataacatgtctgctgaacgttttattgaatattttgag
ttccacacaagttggaaacttaaacagagagaagcgaaaaaactggcgtttgatgtgtct
ctagaagaaaacccagcgtttgctactcatcttcattatgatttagaagcgaatcaatgg
tatattccgtcaacgcgtgattcatttttggggattcctgagatcatcagccattactta
ttgatgtataacctcagtatgattgcccgctatgaaacagaatggtggtacgaactgcta
tctcaatacattagtgatgattacgtcatgatcgaacgctacatggagattgctgaagag
aagttcccagcatatatcatgatgctattagaagaaaaaacaaaaaagaccagttccaaa
tggaactga

DBGET integrated database retrieval system