KEGG   Bacillus pumilus SAFR-032: BPUM_0510Help
Entry
BPUM_0510         CDS       T00599                                 

Definition
(GenBank) chemotaxis protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal DUF3829 ApoLp-III DUF948 DUF1664 T7SS_ESX_EspC Jnk-SapK_ap_N Laminin_II Spc7 Vps53_N Muted Syntaxin_2 CHASE3 TBCC_N AIP3 YtxH Cauli_AT DivIVA TMPIT Tektin DASH_Dad2 Sec34 IFT57 DUF3450 Fib_alpha SKA1 COMP Transposase_24 APG17 GldM_N YkyA Kinesin_assoc TINF2_N DUF4795 DUF4200 CdvA RecG_N CENP-F_leu_zip
Motif
Other DBs
NCBI-ProteinID: ABV61205
UniProt: A8FAD8
Position
23596..24426
Genome map
AA seq 276 aa AA seqDB search
MNRLDYYVEMAQLVRKVLDESILFGITDTEKVLCYYPSNTIDFGMKVGDPLNPEDQNVAT
TLRGQEYDGHLPESLYGYEIAVKGYPIFDENRKVIGSFLVAFSHHREKKLSGYMEHINGV
AKELQSGIEQIAAHSQELAATSLEISEQAGRAEEKSANIEEVVKTIGGIARQTNLLGLNA
AIEAARAGENGKGFAVVADEVRKLSDGSKEAAETINTFLKEIQDSIGTLSENISQISSST
NEQAKQVTDFTKIIESLNEFKEEMNHFIEEIRQDTK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgaataggcttgactattatgttgaaatggctcaattagttagaaaagttctagatgaa
agtattcttttcggcatcactgatacagaaaaggtgctttgctactatccgtctaacaca
atagattttggcatgaaggttggggacccattgaacccagaagaccaaaacgtggcgacg
acattaagaggacaagaatatgacggtcatttaccagagtctttatatggttatgaaatt
gcagtaaaaggttacccgattttcgatgaaaatagaaaagtaattggctcttttttagtg
gcattttcacatcatcgtgaaaagaaattaagcggttatatggagcatatcaatggtgta
gcaaaagaactccaaagtggaattgagcaaattgctgcgcattcacaagagctagctgcc
acaagtttagaaataagtgaacaggcaggaagagcggaagagaaatcagcaaacattgaa
gaagtcgtcaaaaccattggcggtattgctagacaaaccaacttgctaggcctaaatgct
gcaattgaagcagcaagggcaggagagaatggaaaagggtttgctgtcgtggctgatgaa
gttcgtaaattatcagatggctcaaaggaagcggcggaaaccattaataccttcttaaaa
gagatccaagacagcattggtacattgtctgaaaatatctcacaaatcagcagctcaaca
aatgaacaagccaaacaagtgacagattttacgaaaattatcgaatcattaaatgagttt
aaagaagagatgaatcattttattgaagagattagacaggatacaaaatag

DBGET integrated database retrieval system