KEGG   Bacillus pumilus SAFR-032: BPUM_0520Help
Entry
BPUM_0520         CDS       T00599                                 

Definition
(GenBank) transcriptional regulator
  KO
K06317  inhibitor of the pro-sigma K processing machinery
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BofA DUF2892
Motif
Other DBs
NCBI-ProteinID: ABV61215
UniProt: A8FAE8
Position
32207..32470
Genome map
AA seq 87 aa AA seqDB search
MEPVIVIGSILLAVLLLFMSGVQANPFKWLGLIGIKFVAGALFLFCLNLFGESLGLHVSI
NPVTSGISGLLGIPGVAALVVIEKFII
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgttattgtgatcgggtcaattttgctagctgtactattgttgtttatgtca
ggtgttcaagcgaaccccttcaagtggttagggctaattggaataaagtttgtggcaggt
gctctttttttattttgtcttaatctatttggagagagtctaggattacatgtatctatt
aaccctgtaacaagtggcatcagtggtttattgggcattccaggcgtagcagctttagtt
gtaattgaaaaatttattatttaa

DBGET integrated database retrieval system