KEGG   Bacillus pumilus SAFR-032: BPUM_0872Help
Entry
BPUM_0872         CDS       T00599                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bpu03009]
    BPUM_0872
Enzymes [BR:bpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BPUM_0872
Ribosome biogenesis [BR:bpu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BPUM_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Endostatin
Motif
Other DBs
NCBI-ProteinID: ABV61556
UniProt: A8FBD9
Position
complement(954453..955361)
Genome map
AA seq 302 aa AA seqDB search
MIIKGHTLSLKVDEQYHHTSLSHFLKTAVSASKPIIHFWMEHQKVRLNQKPAHHAAKVSQ
GDQIIIDLFETEESDVTPEYGELEVLFEDEHLLIVQKPAGRPTHPNEQGQTGTLANLVAF
HFQANGEEKRVRHIHRLDQDTSGTVIFAKHRLAHAALDQMLSKKTIKRTYIAIAEGLFKK
KKGTIDAAIGRDKHHAVRRRISPTGQKAVTHFQVMDVNKRLQLTAVKLQLETGRTHQIRV
HLSSLGHPLAGDTLYDGVREYINRCALHAKQVDMKHPFTGEHLIIEAPLPPDMDQLMSQI
IH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgattataaaaggacacacgctctcactaaaagtagacgagcagtatcatcacacttca
ctcagtcattttttaaagacagccgtatctgcatcaaaaccgattattcatttttggatg
gagcatcaaaaggttcgtttaaatcaaaagcctgcccatcacgcggctaaagtcagtcaa
ggcgatcagatcatcattgatttatttgaaacagaagaaagtgatgtgacaccggaatac
ggtgaattagaagtactcttcgaagacgagcatttattaattgtacaaaaacctgccgga
cgaccaactcatccgaatgaacaaggacaaactggcacactggcaaatcttgtggcattt
catttccaagcaaatggagaagaaaagcgggtaagacatatccacaggctagatcaagac
acaagcggaaccgtcatttttgcaaagcatagattagctcatgcggctcttgatcaaatg
ctttctaaaaaaacaattaaacgcacatatatcgccatagcagagggacttttcaaaaag
aagaaaggcaccatcgatgcagcgatcggtcgtgacaaacaccacgcagtgagacgaaga
atttctcctacagggcaaaaagctgtgactcattttcaggtcatggacgtgaataaacgt
ctgcaactaacagcggttaaactacaactagagacgggtagaacgcatcaaattcgtgtc
caccttagcagtctcgggcacccactagctggagatacgttatatgacggagttcgtgaa
tacatcaacaggtgtgctcttcacgccaagcaagttgacatgaaacatccttttacaggt
gagcatctgatcatagaagctcctttaccacctgatatggaccaactcatgagtcaaatc
atccattaa

DBGET integrated database retrieval system