KEGG   Bacillus pumilus SAFR-032: BPUM_0960Help
Entry
BPUM_0960         CDS       T00599                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00860  Porphyrin and chlorophyll metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPUM_0960
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BPUM_0960
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BPUM_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO MCRA HI0933_like Pyr_redox_2 Pyr_redox Trp_halogenase Thi4 Bin3
Motif
Other DBs
NCBI-ProteinID: ABV61644
UniProt: A8FBM7
Position
1036993..1038405
Genome map
AA seq 470 aa AA seqDB search
MHDNQKHLVIIGGGITGLAAAFYLEKEVEEKGLPIQISLIEASPRLGGKIQTLYKDGYII
ERGPDSFLERKVSGPQLAKDVGLSDQLVNNETGQAYVLVNEKLHPMPKGAVMGIPTQISP
FITTGLFSVAGKARAAMDFVLPKSKQTEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDRLSLMSTFPQFYQTEQKHRSLILGMKKSQQHAKAQQVTAKKQGQFQTINQGLQSLVEA
VESKLKLTTVYKGTKVKQIEKTDGGYGLQLDSGQTLFADSAIVTTPHQSIYSMFPKEAGL
EYLHDMTSTSVATVALGFKDEDVHNEYDGTGFVISRNSDFSITACTWTNKKWPHTAPKGK
TLLRAYVGKAGDESIVEQSDSQIVSIVLEDLKKIMDIKADPELTTVTRWKTSMPQYHVGH
QKAISNMRETFKQSYPGVYITGAAFEGVGIPDCIDQGKAAISEAVSYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacaatcaaaaacaccttgtcatcattggcggtggcatcactggtttagccgcc
gccttctatttggaaaaggaagtcgaggaaaaaggtcttccgattcaaatatcacttatt
gaagcgagccctaggctaggtggaaaaatacaaacattatataaagacggctacatcatt
gaacgtggacctgattcatttttagaaagaaaggtcagtgggccgcagcttgcaaaagat
gtcggtctgtccgatcagctcgtcaataatgaaactgggcaagcgtatgtactggtcaat
gaaaagcttcacccgatgccaaaaggtgctgttatggggattccaactcaaatcagccca
tttattacaactggtcttttttcagttgcgggaaaagcaagggcggcgatggatttcgta
ctgccaaaaagcaagcagacagaagatcagtcgctcggtgaattttttagaagacgtgtc
ggtgatgaagtagttgagaatttaattgagccgcttctatcaggcatttatgcaggggat
attgaccgtctgagcttaatgtcgaccttcccgcaattttatcaaacagaacaaaagcat
cgcagtttgattcttgggatgaaaaaatcacagcagcatgcgaaagcgcagcaagtgact
gcgaaaaaacaaggacagttccaaacgatcaatcaaggattgcagtcgcttgtggaagca
gtagaaagtaagctcaagctgacaacggtctataaagggacaaaagtcaaacaaattgaa
aaaacggatggaggctatggcttacaattagacagcggtcaaacgctttttgccgattca
gccattgtcacgactccgcatcaatcgatttattccatgtttcctaaagaagcagggcta
gagtatttgcatgacatgacctctacttctgttgcaacagtagcactcggttttaaagat
gaggatgttcataatgagtatgatggcactggttttgtcatctcaagaaacagtgatttc
tctattacggcctgtacatggacaaacaaaaaatggccgcatactgctccgaaaggaaaa
acgctattgcgtgcgtatgtagggaaggctggcgacgaatcaattgtcgagcagtcagac
agtcaaatcgtcagcattgtgctagaagatttaaagaaaatcatggatattaaagcagat
ccagaattgacgacagtgactcgctggaagacaagtatgccgcaatatcacgtcggtcat
cagaaagccatttcgaacatgcgagaaacgtttaagcaatcatatcctggtgtttatatt
acaggtgctgcttttgaaggtgtcggaatccctgattgtattgatcaaggaaaagccgcc
atctcagaggctgtatcgtatctattttcataa

DBGET integrated database retrieval system