KEGG   Bacillus pumilus SAFR-032: BPUM_1357Help
Entry
BPUM_1357         CDS       T00599                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00010  Glycolysis / Gluconeogenesis
bpu00020  Citrate cycle (TCA cycle)
bpu00620  Pyruvate metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
Module
bpu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPUM_1357
   00020 Citrate cycle (TCA cycle)
    BPUM_1357
   00620 Pyruvate metabolism
    BPUM_1357
Enzymes [BR:bpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BPUM_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N DUF5077
Motif
Other DBs
NCBI-ProteinID: ABV62040
UniProt: A8FCS3
Position
1412049..1413392
Genome map
AA seq 447 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEINEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYENLQFKGSEEEGEAKTEAQVQGTAEAGNEPEKKEVAQEE
AAAATDAGAQEQVDADPNKRVIAMPSVRKYAREKGIEIYKVAGSGKNGRVLKEDIDSFVN
GGSATQEAAPQAAESAKEEAAPKAAAAAPVLEGEFPETREKMSGIRKAIAKAMVNSKHTA
PHVTLMDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKYPVLNTSIDDKT
DEVVQKHYYNIGIAADTEKGLLVPVVKNADRKAIFEVSNEINELATKARDGKLAPAEMKG
ASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKAVVRDGEIVAAPVLALSLSFDHRM
IDGATAQNALNHIKRLLNDPQLILMEA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccggacatcggagaaggtatccacgaaggtgagatcgtt
aagtggtttgtaaaaccaaacgacgaaattaatgaagatgacgttttagcagaggtacaa
aacgataaagcagttgtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacagttgcaactgtaggacaaacaatcattacgtttgatgcacctggt
tacgaaaatcttcaatttaaaggcagcgaagaagaaggcgaagcaaaaactgaagctcag
gtacaaggtactgctgaagctggtaacgagccagagaagaaagaagtagcacaagaagaa
gcggcagcagcaactgatgcaggcgcacaagagcaagtagatgctgatccaaacaaacgc
gttatcgctatgccatctgtacgtaaatatgcccgcgaaaaaggcattgaaatttacaaa
gttgcaggttctggtaaaaacggacgtgtgttaaaagaagatatcgacagcttcgttaat
ggtggttctgcaactcaagaagcagcgcctcaagcagctgaaagtgcaaaagaagaagca
gctcctaaagcggcagcagcagctccagttcttgaaggagaattcccagaaactcgcgag
aaaatgagcggtatccgtaaagcgatcgcgaaagcaatggtgaactctaagcatacagct
cctcacgtaacattaatggatgaagtggatgtaacgaaccttgttgctcatcgtaaacaa
ttcaaacaagttgcagctgatcaaggaatcaagttaacttacttgccttacgttgtaaaa
gctcttacttctgctttgaaaaagtacccagtacttaacacttctatcgatgataaaaca
gatgaagttgttcaaaaacattactacaacatcggaattgcagctgatactgaaaaaggc
ttgcttgttccagttgtgaaaaatgcagatcgcaaagcaattttcgaagtatctaacgaa
atcaacgagcttgcaacaaaagcacgtgatggtaaattggctccagctgaaatgaaaggt
gcatcttgcacaatcacaaacatcggttctgctggtggacaatggtttactccagttatc
aaccacccagaagtagcgatccttggtattggccgtatcgctgaaaaagcggttgttcgt
gatggcgaaatcgttgcagctccagtcttagctctttccctaagctttgaccaccgtatg
atcgacggagctactgcgcaaaatgcccttaaccacatcaagcgtttattgaatgatcca
caattaattttaatggaggcgtaa

DBGET integrated database retrieval system