KEGG   Bacillus pumilus SAFR-032: BPUM_1507Help
Entry
BPUM_1507         CDS       T00599                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00020  Citrate cycle (TCA cycle)
bpu00640  Propanoate metabolism
bpu00660  C5-Branched dibasic acid metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
Module
bpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPUM_1507 (sucC)
   00640 Propanoate metabolism
    BPUM_1507 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BPUM_1507 (sucC)
Enzymes [BR:bpu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BPUM_1507 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABV62190
UniProt: A8FD73
Position
1561037..1562197
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEILRKYGVSVPNGKVAFTPDEAVKASEELESSVYVVKAQIHAGGRGKAGGV
KIAKTKDEVKGFAEELLGKTLVTHQTGPEGREIKRLLIEEGCDIQKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIVKVVIDPAIGLQGYQAREVAFKINIPTKLVGQAVKF
MTSLYNAFIEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRQKDILEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGDPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATKQVGLTLPLVVRLEGTNVELGKKI
LSDSGLNITSAESMADGAEKIVSLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggaaaagaaatcctaagaaaatatggggtttcagttcca
aatggtaaagtagcatttacacctgatgaagcagtgaaagcatcagaagagctagaaagc
tctgtatatgtcgtaaaagcacagattcatgcaggcggccgtggcaaagcaggcggggta
aaaattgcaaaaacaaaagatgaagtgaaagggtttgcagaggaattgctcggcaaaaca
cttgtcacacatcaaactggtcctgagggacgcgaaataaaacgcttacttattgaagaa
ggctgcgatatccaaaaggagtactacgtaggacttgttttggacagagcgacatcaaga
attgtattgatggcttctgaagaaggcggtactgaaattgaagaagtagcagaaaaaacg
ccagaaaaaatcgtcaaagtggtcatcgacccagcgattggattgcaaggctatcaggcg
agagaagtagcgtttaaaattaatattccaacaaaattagttggccaagctgttaagttt
atgacaagtctttacaatgcgttcattgaaaaagattgttcaattgctgagattaatcca
cttgttgtaacaggcgatggaaaagtcatggcacttgatgcgaaattaaactttgatagc
aatgccttatatagacaaaaagatatattagaataccgtgaccttgatgaagaggatcca
aaagaaattgaagcatctaaatatgatctgagctacatttctctagatggaaatatcggc
tgtatggtcaatggtgcaggtcttgcgatgtctacaatggatatcatcaagcattacggc
ggggaccctgcaaacttcctggatgttggcggcggtgcaacagctgaaaaagtaacggaa
gcatttaaaatcatcttatctgatcaaaatgtaaaagggattttcgtgaacatttttggc
ggcatcatgaaatgtgatgtcattgcagaaggtgtcgttgaagcgacgaaacaagtcggc
ttaacattaccactcgttgtacgtcttgaaggaacaaacgttgaattagggaagaaaatc
ctgagcgattcaggcttaaatatcacttctgctgagtctatggctgacggggcagaaaag
attgtatctttagtcaagtag

DBGET integrated database retrieval system